Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5534
Gene name
LocationContig_43:109967..112112
Strand-
Gene length (bp)2145
Transcript length (bp)1857
Coding sequence length (bp)1857
Protein length (aa) 619

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 5.7E-11 350 377
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 4.3E-07 428 457
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.9E-08 255 322
PF00929 RNase_T Exonuclease 2.6E-05 19 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13801|YE04_SCHPO Uncharacterized RNA-binding protein C17H9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.04c PE=1 SV=1 8 465 4.0E-121
sp|P32770|NRP1_YEAST Asparagine-rich protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRP1 PE=1 SV=2 105 377 7.0E-78
sp|P32770|NRP1_YEAST Asparagine-rich protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRP1 PE=1 SV=2 419 487 4.0E-09
sp|Q8C460|ERI3_MOUSE ERI1 exoribonuclease 3 OS=Mus musculus GN=Eri3 PE=1 SV=1 4 149 3.0E-08
sp|Q5HZL1|ERI2_XENLA ERI1 exoribonuclease 2 OS=Xenopus laevis GN=eri2 PE=2 SV=1 13 160 1.0E-06

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2667
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2638
Ophiocordyceps australis map64 (Brazil) OphauB2|5534 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00585
Ophiocordyceps camponoti-rufipedis Ophun1|1023
Ophiocordyceps kimflemingae Ophio5|7710
Ophiocordyceps subramaniannii Hirsu2|4131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5534
MSAPPQLNVDRYVVIHVATTCDEHGVYVTKDSAEVIELGWILLDANSLEEITHDSALVKPVNTPITPLCTSLTTL
TWEHVRNAGTFRDAISRFDTFATEYLTSKNLDFVFVTLDAWDLRVQLPREARDKAVVLPPYLQHSRTFDLRTEYQ
RWQQHHPESLPFGPSMLSNICAALEVEPVQCSAPIKHNLPFHLQALAPASPRRAMEEAITLARVLRGLIRKSQPP
QDHPDVLTRPMDARADVRAFLSERSKVLHMSGLPHDTTQSELESWFTQFGGRPIAFWTLRTPEQHKPTGTGFAVF
SSHEEAAESLCMNGRALNEKAIEVSPSSSRVLDRAQDILTPFPPSKNRPRPGDWTCPSCGFSNFQRRTACFRCSF
PAMGPGAGGEIAGPSGYGYNYGPPAMMAPPHGGHHGPMGHGGRMGGSGVVPFRAGDWKCGNEVCGYHNFAKNVCC
LRCGASRAGAAVVADSGYPSPMDNSSQYSMSGGSMAGTPAPGPFGSGNSFASGSGYNQHFGGPPSHFLPSGLGGG
AGAYPSALNTQGFGAAPGSHSAGPFDSRAAEAAFQSATNGPASAGPGPTNNFYNNNGENDPFAFLSTGIGGLTVG
GSDARQNGGGAPPSKSPA*
Coding >OphauB2|5534
ATGTCTGCGCCACCGCAGCTCAACGTCGATCGCTACGTCGTTATCCATGTGGCTACGACGTGTGACGAGCATGGA
GTTTACGTCACCAAGGACTCGGCCGAGGTTATTGAGCTTGGATGGATCCTTCTTGATGCAAACTCTCTCGAGGAG
ATTACACACGACAGTGCTCTGGTGAAGCCTGTCAATACTCCAATTACGCCTCTGTGCACGAGCCTCACCACTCTT
ACCTGGGAACATGTGCGGAATGCCGGCACCTTTCGAGATGCCATTTCTCGATTCGACACTTTTGCTACCGAGTAT
CTCACGTCCAAGAACCTCGACTTCGTTTTTGTCACGCTCGATGCTTGGGATCTTCGCGTGCAGCTTCCCAGGGAA
GCTCGTGACAAGGCAGTCGTGCTGCCTCCTTACCTCCAGCACTCGCGAACCTTTGATCTGCGAACCGAATACCAG
CGCTGGCAACAGCATCACCCCGAGTCTCTTCCGTTTGGGCCGTCAATGCTATCCAATATCTGCGCTGCCCTCGAG
GTGGAGCCTGTGCAGTGCAGCGCTCCCATAAAACATAATCTGCCTTTTCATTTGCAGGCCCTCGCTCCCGCCTCG
CCACGCCGCGCCATGGAAGAGGCCATTACCCTTGCTCGCGTGCTGCGAGGGCTGATTCGCAAGTCGCAGCCCCCA
CAGGACCACCCAGATGTCTTGACTAGACCCATGGATGCTAGGGCTGACGTTCGGGCTTTCTTGTCTGAGAGGAGT
AAAGTGCTCCACATGTCGGGGCTTCCCCACGATACCACCCAGTCTGAGCTTGAAAGCTGGTTTACGCAGTTTGGC
GGTCGCCCAATTGCCTTTTGGACGCTGCGCACTCCGGAGCAGCATAAACCAACGGGCACCGGGTTTGCCGTTTTT
TCGTCTCATGAAGAGGCTGCCGAGAGCTTGTGCATGAATGGACGTGCGCTCAACGAAAAGGCCATTGAGGTGTCA
CCCTCGTCGAGCCGGGTTCTAGACCGCGCCCAAGACATACTTACCCCATTTCCACCCAGCAAGAACCGCCCTCGG
CCTGGTGACTGGACCTGCCCGTCGTGCGGCTTCTCCAATTTTCAGCGCCGAACAGCATGCTTCAGATGCTCCTTT
CCTGCCATGGGACCCGGGGCTGGGGGTGAGATTGCGGGCCCTAGCGGATACGGATATAATTATGGCCCTCCTGCC
ATGATGGCTCCTCCCCATGGCGGCCATCACGGCCCAATGGGTCATGGCGGCCGCATGGGAGGCAGTGGTGTAGTG
CCCTTCCGAGCCGGTGATTGGAAATGCGGCAATGAAGTGTGCGGCTACCACAACTTTGCCAAGAATGTCTGCTGT
CTTCGCTGCGGTGCCAGCCGCGCCGGAGCGGCCGTGGTTGCCGACTCGGGGTACCCATCGCCCATGGACAATTCG
TCTCAGTACAGCATGAGCGGTGGCTCCATGGCTGGGACGCCTGCCCCAGGGCCCTTTGGCTCTGGCAATTCATTT
GCATCTGGCTCTGGCTACAACCAGCACTTTGGGGGCCCACCAAGCCATTTCCTACCATCGGGTCTCGGGGGAGGC
GCTGGAGCTTATCCCAGCGCCCTCAACACGCAGGGCTTTGGCGCAGCGCCAGGCTCACACTCTGCTGGGCCCTTT
GATAGCAGGGCTGCCGAAGCTGCCTTCCAGTCTGCAACGAATGGTCCCGCCTCGGCCGGCCCTGGCCCGACCAAC
AACTTTTACAACAATAATGGCGAGAACGATCCCTTTGCCTTTTTGTCGACAGGAATCGGCGGCCTCACGGTGGGA
GGCAGCGATGCCCGACAGAATGGCGGCGGTGCTCCCCCGAGCAAGTCTCCCGCGTAG
Transcript >OphauB2|5534
ATGTCTGCGCCACCGCAGCTCAACGTCGATCGCTACGTCGTTATCCATGTGGCTACGACGTGTGACGAGCATGGA
GTTTACGTCACCAAGGACTCGGCCGAGGTTATTGAGCTTGGATGGATCCTTCTTGATGCAAACTCTCTCGAGGAG
ATTACACACGACAGTGCTCTGGTGAAGCCTGTCAATACTCCAATTACGCCTCTGTGCACGAGCCTCACCACTCTT
ACCTGGGAACATGTGCGGAATGCCGGCACCTTTCGAGATGCCATTTCTCGATTCGACACTTTTGCTACCGAGTAT
CTCACGTCCAAGAACCTCGACTTCGTTTTTGTCACGCTCGATGCTTGGGATCTTCGCGTGCAGCTTCCCAGGGAA
GCTCGTGACAAGGCAGTCGTGCTGCCTCCTTACCTCCAGCACTCGCGAACCTTTGATCTGCGAACCGAATACCAG
CGCTGGCAACAGCATCACCCCGAGTCTCTTCCGTTTGGGCCGTCAATGCTATCCAATATCTGCGCTGCCCTCGAG
GTGGAGCCTGTGCAGTGCAGCGCTCCCATAAAACATAATCTGCCTTTTCATTTGCAGGCCCTCGCTCCCGCCTCG
CCACGCCGCGCCATGGAAGAGGCCATTACCCTTGCTCGCGTGCTGCGAGGGCTGATTCGCAAGTCGCAGCCCCCA
CAGGACCACCCAGATGTCTTGACTAGACCCATGGATGCTAGGGCTGACGTTCGGGCTTTCTTGTCTGAGAGGAGT
AAAGTGCTCCACATGTCGGGGCTTCCCCACGATACCACCCAGTCTGAGCTTGAAAGCTGGTTTACGCAGTTTGGC
GGTCGCCCAATTGCCTTTTGGACGCTGCGCACTCCGGAGCAGCATAAACCAACGGGCACCGGGTTTGCCGTTTTT
TCGTCTCATGAAGAGGCTGCCGAGAGCTTGTGCATGAATGGACGTGCGCTCAACGAAAAGGCCATTGAGGTGTCA
CCCTCGTCGAGCCGGGTTCTAGACCGCGCCCAAGACATACTTACCCCATTTCCACCCAGCAAGAACCGCCCTCGG
CCTGGTGACTGGACCTGCCCGTCGTGCGGCTTCTCCAATTTTCAGCGCCGAACAGCATGCTTCAGATGCTCCTTT
CCTGCCATGGGACCCGGGGCTGGGGGTGAGATTGCGGGCCCTAGCGGATACGGATATAATTATGGCCCTCCTGCC
ATGATGGCTCCTCCCCATGGCGGCCATCACGGCCCAATGGGTCATGGCGGCCGCATGGGAGGCAGTGGTGTAGTG
CCCTTCCGAGCCGGTGATTGGAAATGCGGCAATGAAGTGTGCGGCTACCACAACTTTGCCAAGAATGTCTGCTGT
CTTCGCTGCGGTGCCAGCCGCGCCGGAGCGGCCGTGGTTGCCGACTCGGGGTACCCATCGCCCATGGACAATTCG
TCTCAGTACAGCATGAGCGGTGGCTCCATGGCTGGGACGCCTGCCCCAGGGCCCTTTGGCTCTGGCAATTCATTT
GCATCTGGCTCTGGCTACAACCAGCACTTTGGGGGCCCACCAAGCCATTTCCTACCATCGGGTCTCGGGGGAGGC
GCTGGAGCTTATCCCAGCGCCCTCAACACGCAGGGCTTTGGCGCAGCGCCAGGCTCACACTCTGCTGGGCCCTTT
GATAGCAGGGCTGCCGAAGCTGCCTTCCAGTCTGCAACGAATGGTCCCGCCTCGGCCGGCCCTGGCCCGACCAAC
AACTTTTACAACAATAATGGCGAGAACGATCCCTTTGCCTTTTTGTCGACAGGAATCGGCGGCCTCACGGTGGGA
GGCAGCGATGCCCGACAGAATGGCGGCGGTGCTCCCCCGAGCAAGTCTCCCGCGTAG
Gene >OphauB2|5534
ATGTCTGCGCCACCGCAGCTCAACGTCGATCGCTACGTCGTTATCCATGTGGCTACGACGTGTGACGAGCATGGA
GTTTACGTCACCAAGGACTCGGCCGAGGTTATTGAGCTTGGATGGATCCTTCTTGATGCAAACTCTCTCGAGGAG
GTCAGTCGTCTCCTCAGCAGCTGCCTGTTGCGCCCGACTGACGTCCAGGGTAGATTACACACGACAGTGCTCTGG
TGAAGCCTGTCAATACTCCAATTACGCCTCTGTGCAGTATGCCACTCCAATGCGCCTTTTATATTCCTTGTCCCG
ACCCTTGTTGTCGACCATGGCTTCTTGAAGCAGCCTAGATAGCAGTCGTTGCGCTTTGTCAATTCTCGTCCCCCA
GACCCTTCAAATCCCCACTCCCCTGTCTGACAAGGCTGACAAGTGCTCTCTTCTTTTAGCGAGCCTCACCACTCT
TACCTGGGAACATGTGCGGAATGCCGGCACCTTTCGAGATGCCATTTCTCGATTCGACACTTTTGCTACCGAGTA
TCTCACGTCCAAGAACCTCGACTTCGTTTTTGTCACGCTCGATGCTTGGGATCTTCGCGTGCAGCTTCCCAGGGA
AGCTCGTGACAAGGCAGTCGTGCTGCCTCCTTACCTCCAGCACTCGCGAACCTTTGATCTGCGAACCGAATACCA
GCGCTGGCAACAGCATCACCCCGAGTCTCTTCCGTTTGGGCCGTCAATGCTATCCAATATCTGCGCTGCCCTCGA
GGTGGAGCCTGTGCAGTGCAGCGCTCCCATAAAACATAATCTGCCTTTTCATTTGCAGGCCCTCGCTCCCGCCTC
GCCACGCCGCGCCATGGAAGAGGCCATTACCCTTGCTCGCGTGCTGCGAGGGCTGATTCGCAAGTCGCAGCCCCC
ACAGGACCACCCAGATGTCTTGACTAGACCCATGGATGCTAGGGCTGACGTTCGGGCTTTCTTGTCTGAGAGGAG
TAAAGTGCTCCACATGTCGGGGCTTCCCCACGATACCACCCAGTCTGAGCTTGAAAGCTGGTTTACGCAGTTTGG
CGGTCGCCCAATTGCCTTTTGGACGCTGCGCACTCCGGAGCAGCATAAACCAACGGGCACCGGGTTTGCCGTTTT
TTCGTCTCATGAAGAGGTATATTCAACTTTTGCCTCTGAATTACACGTCGTGTAGACTGACTAGAATGATTTATG
CAGGCTGCCGAGAGCTTGTGCATGAATGGACGTGCGCTCAACGAAAAGGCCATTGAGGTGTCACCCTCGTCGAGC
CGGGTTCTAGACCGCGCCCAAGACATACTTACCCCATTTCCACCCAGCAAGAACCGCCCTCGGCCTGGTGACTGG
ACCTGCCCGTCGTGCGGCTTCTCCAATTTTCAGCGCCGAACAGCATGCTTCAGATGCTCCTTTCCTGCCATGGGA
CCCGGGGCTGGGGGTGAGATTGCGGGCCCTAGCGGATACGGATATAATTATGGCCCTCCTGCCATGATGGCTCCT
CCCCATGGCGGCCATCACGGCCCAATGGGTCATGGCGGCCGCATGGGAGGCAGTGGTGTAGTGCCCTTCCGAGCC
GGTGATTGGAAATGCGGCAATGAAGTGTGCGGCTACCACAACTTTGCCAAGAATGTCTGCTGTCTTCGCTGCGGT
GCCAGCCGCGCCGGAGCGGCCGTGGTTGCCGACTCGGGGTACCCATCGCCCATGGACAATTCGTCTCAGTACAGC
ATGAGCGGTGGCTCCATGGCTGGGACGCCTGCCCCAGGGCCCTTTGGCTCTGGCAATTCATTTGCATCTGGCTCT
GGCTACAACCAGCACTTTGGGGGCCCACCAAGCCATTTCCTACCATCGGGTCTCGGGGGAGGCGCTGGAGCTTAT
CCCAGCGCCCTCAACACGCAGGGCTTTGGCGCAGCGCCAGGCTCACACTCTGCTGGGCCCTTTGATAGCAGGGCT
GCCGAAGCTGCCTTCCAGTCTGCAACGAATGGTCCCGCCTCGGCCGGCCCTGGCCCGACCAACAACTTTTACAAC
AATAATGGCGAGAACGATCCCTTTGCCTTTTTGTCGACAGGAATCGGCGGCCTCACGGTGGGAGGCAGCGATGCC
CGACAGAATGGCGGCGGTGCTCCCCCGAGCAAGTCTCCCGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail