Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5529
Gene name
LocationContig_43:93526..97136
Strand-
Gene length (bp)3610
Transcript length (bp)3441
Coding sequence length (bp)3441
Protein length (aa) 1147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain 2.4E-35 600 782

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13769|ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp2 PE=1 SV=2 575 816 2.0E-45
sp|A7MBJ2|SENP7_BOVIN Sentrin-specific protease 7 OS=Bos taurus GN=SENP7 PE=2 SV=1 578 820 3.0E-28
sp|Q8BUH8|SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus GN=Senp7 PE=1 SV=1 578 820 6.0E-27
sp|Q9BQF6|SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens GN=SENP7 PE=1 SV=4 564 820 8.0E-27
sp|D3ZF42|SENP7_RAT Sentrin-specific protease 7 OS=Rattus norvegicus GN=Senp7 PE=1 SV=1 578 820 8.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13769|ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp2 PE=1 SV=2 575 816 2.0E-45
sp|A7MBJ2|SENP7_BOVIN Sentrin-specific protease 7 OS=Bos taurus GN=SENP7 PE=2 SV=1 578 820 3.0E-28
sp|Q8BUH8|SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus GN=Senp7 PE=1 SV=1 578 820 6.0E-27
sp|Q9BQF6|SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens GN=SENP7 PE=1 SV=4 564 820 8.0E-27
sp|D3ZF42|SENP7_RAT Sentrin-specific protease 7 OS=Rattus norvegicus GN=Senp7 PE=1 SV=1 578 820 8.0E-27
sp|P40537|ULP2_YEAST Ubiquitin-like-specific protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP2 PE=1 SV=1 571 784 3.0E-25
sp|P59110|SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus GN=Senp1 PE=2 SV=1 584 774 1.0E-21
sp|Q9P0U3|SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens GN=SENP1 PE=1 SV=2 584 774 4.0E-21
sp|Q5RBB1|SENP1_PONAB Sentrin-specific protease 1 OS=Pongo abelii GN=SENP1 PE=2 SV=1 584 774 5.0E-21
sp|Q5R7K7|SENP2_PONAB Sentrin-specific protease 2 OS=Pongo abelii GN=SENP2 PE=2 SV=1 587 774 1.0E-20
sp|Q9HC62|SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens GN=SENP2 PE=1 SV=3 587 774 3.0E-20
sp|Q91ZX6|SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus GN=Senp2 PE=1 SV=2 587 774 1.0E-19
sp|Q9GZR1|SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens GN=SENP6 PE=1 SV=2 578 682 2.0E-19
sp|Q9EQE1|SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus GN=Senp2 PE=1 SV=1 587 774 8.0E-19
sp|Q6P7W0|SENP6_MOUSE Sentrin-specific protease 6 OS=Mus musculus GN=Senp6 PE=1 SV=3 578 682 2.0E-18
sp|Q8RWN0|ULP1C_ARATH Ubiquitin-like-specific protease 1C OS=Arabidopsis thaliana GN=ULP1C PE=1 SV=1 581 777 9.0E-18
sp|Q8L7S0|ULP2B_ARATH Probable ubiquitin-like-specific protease 2B OS=Arabidopsis thaliana GN=ULP2B PE=1 SV=3 575 838 1.0E-17
sp|Q8WP32|SENP5_MACFA Sentrin-specific protease 5 OS=Macaca fascicularis GN=SENP5 PE=2 SV=1 583 774 1.0E-17
sp|Q96HI0|SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens GN=SENP5 PE=1 SV=3 583 774 2.0E-17
sp|Q09353|SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans GN=ulp-1 PE=2 SV=3 591 774 7.0E-17
sp|Q6NXL6|SENP5_MOUSE Sentrin-specific protease 5 OS=Mus musculus GN=Senp5 PE=2 SV=1 583 774 1.0E-16
sp|Q0WKV8|ULP2A_ARATH Probable ubiquitin-like-specific protease 2A OS=Arabidopsis thaliana GN=ULP2A PE=2 SV=2 575 777 3.0E-16
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 601 776 1.0E-14
sp|Q2PS26|ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana GN=ULP1D PE=1 SV=1 599 813 5.0E-14
sp|Q9EP97|SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus GN=Senp3 PE=1 SV=1 584 776 1.0E-13
sp|Q9H4L4|SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens GN=SENP3 PE=1 SV=2 584 776 2.0E-13
sp|O65278|ULP1B_ARATH Putative ubiquitin-like-specific protease 1B OS=Arabidopsis thaliana GN=ULP1B PE=5 SV=2 598 776 2.0E-13
sp|Q8GYL3|ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana GN=ULP1A PE=2 SV=2 516 783 3.0E-13
sp|O42957|ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp1 PE=3 SV=1 547 768 3.0E-12
sp|Q09275|ULP4_CAEEL Ubiquitin-like protease 4 OS=Caenorhabditis elegans GN=ulp-4 PE=2 SV=2 591 780 8.0E-11
sp|Q9GZR1|SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens GN=SENP6 PE=1 SV=2 709 837 4.0E-09
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 599 769 4.0E-08
sp|Q6P7W0|SENP6_MOUSE Sentrin-specific protease 6 OS=Mus musculus GN=Senp6 PE=1 SV=3 709 834 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008234 cysteine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5529
MSASVHGQPPPSQQQQRHNGSGPNRLPRSDNVILLSDEDSDSDSRQALDQAKPTCGGSDKPAGEATQRQGPLDSS
HHESETMGKYRMNIINKTAVCPVNTLSRKDTKSSHTSSLSAKSCASQGSRAVASLRLERKTSLSTQPEIHDLTGP
SRTGVTVTPEAADCDSFEVPEWHLRLVPGRRESKSHGIRLASSVTKTPSKVKGSNTDATKQALFKPWNRQKESPD
ILSCDDPPAARVESDLLLHSPLGQRGILANSEQKQKLGSLKRHGALEGKERLDSEDELGAEPKRLGKRDTNFAHV
GNPRQTRMRNREIHSSDFTTDRQTQSLHVIKAVCGSVMYTQQGNRAVRLERRDPGKPLLVPVNESGKEIGHLKWM
GIDLSSIKSLERSEPNAHGAFVVIHRPKTHDAMSQLCLEFEPSSNLSVLSGKITDSLKLERIVKKAFKDAQLRQL
SHKNHGSTKDDSQPTPWLPNTSADTINGTKNQDAPKQHEGLVSKMRSAAQKTTGKEEAVKAIKSPLVSDKASPTM
SASSRFFPTPSRPTTRRTRQSSPPPAKRQRTPESWTAKNPDWQKAWKSSLVFPATGKNRATVDADDIVRLDEGQL
LNDNLLAFYLRYLEHKLEVQNSEAQSKVYIFSTFFYEKLRSTRSKINYEGVKTWTAKIDLFSYDYVIVPVNESAH
WYLAIICNLPNTLKNCNKNDDESGGARMVDVMLPKIITLDSLGQQRSAACRCLREYLVEEARHKKGVDLVTIPNG
MTAKSLPEQGNGSDCGVYLLAYTEQFLNNPEECCRKLYQKENLGWKVDSCQLRSDIRTLILRLQQEQQQAPAKKK
QKRVESKLASMGMSGQKQGQDANSRSLEDLPTIPKISCKDAAPECVESRGEAKPRQTPKANDVVESPQVVKAHGV
AKPPETATSHGVVNSLELVEVRHDAVQSQHKAESPQIIESPDGTKSLKASVSNAIKTSNSNSSRGASTATNGVQS
RIHQPPGAAPGATLNPRAESAAQATDVLYNGDDDVKLISCIKSSSSPSTESCNSIYHSAQSSPTRQLRLDKADTA
SKSATAKKKKKPFSALPIVSVEDSNSSHRVSTILSSPEPDFEIIKDEAAKANLRKRHLERHGKESKRAPKSLDIP
DAKRHCARYEGVSRANNGGVI*
Coding >OphauB2|5529
ATGTCCGCATCCGTGCATGGCCAACCTCCTCCTTCGCAGCAGCAGCAGCGCCACAACGGCTCGGGCCCGAACAGA
TTACCTCGCAGCGACAACGTCATCCTGCTGAGCGACGAGGACTCGGACTCGGACTCGAGGCAGGCCCTTGACCAG
GCAAAGCCCACCTGTGGCGGGAGCGACAAGCCAGCAGGGGAAGCTACTCAACGGCAAGGGCCTTTGGACTCGTCC
CATCATGAGAGCGAGACCATGGGCAAATATCGCATGAATATTATCAACAAGACCGCCGTGTGCCCCGTCAACACC
TTGAGCAGAAAAGACACAAAATCTTCGCATACCTCATCTTTGAGCGCCAAGTCGTGCGCTTCACAAGGATCCAGG
GCTGTAGCTTCCCTAAGACTCGAAAGAAAAACCTCCTTGTCGACACAGCCCGAGATCCACGATCTCACCGGCCCC
TCACGGACCGGCGTCACAGTCACCCCAGAGGCGGCCGATTGCGACTCTTTTGAGGTACCAGAATGGCATTTGCGT
CTGGTTCCTGGTAGACGAGAATCCAAGTCTCATGGTATCCGACTGGCGTCTTCAGTAACAAAAACCCCTTCAAAA
GTCAAAGGCAGTAACACAGATGCGACTAAACAGGCTCTGTTTAAACCCTGGAACCGCCAAAAAGAAAGTCCTGAT
ATTCTGTCCTGCGACGACCCCCCAGCGGCGCGTGTTGAGTCAGACTTGCTGCTGCACAGCCCACTTGGCCAGAGA
GGCATACTGGCCAACTCTGAGCAGAAGCAGAAACTTGGCTCTTTGAAGCGCCATGGAGCGCTTGAAGGCAAGGAG
AGACTCGATTCTGAAGATGAATTAGGGGCAGAACCGAAGCGCTTGGGCAAACGTGATACCAACTTTGCCCATGTA
GGCAATCCGAGGCAAACACGCATGCGAAACCGCGAGATTCATTCCTCCGACTTTACTACCGACCGTCAAACCCAA
TCTCTGCATGTCATCAAAGCAGTTTGTGGAAGCGTAATGTATACACAACAAGGAAATCGCGCTGTAAGGCTCGAG
AGGAGAGACCCTGGGAAACCTCTGCTGGTGCCAGTCAATGAATCCGGCAAGGAAATTGGCCATCTCAAATGGATG
GGCATCGACTTGAGTTCCATCAAGAGTTTGGAGCGTTCCGAGCCCAACGCACATGGTGCTTTTGTCGTTATACAT
CGACCCAAGACGCACGACGCCATGAGCCAGCTCTGCCTCGAGTTTGAGCCTTCAAGTAATCTCTCAGTCCTCAGC
GGGAAAATTACAGATTCTTTAAAACTTGAACGCATTGTGAAGAAGGCTTTTAAGGATGCACAATTGCGGCAGCTC
TCCCACAAGAACCATGGCTCGACCAAGGACGACTCTCAGCCAACACCATGGCTACCAAATACATCGGCCGATACG
ATTAATGGAACCAAAAATCAGGATGCGCCCAAGCAACATGAAGGCCTGGTTAGTAAGATGCGAAGTGCAGCCCAG
AAAACGACTGGTAAGGAGGAAGCTGTCAAGGCAATCAAGTCACCTCTTGTATCAGACAAGGCCAGTCCGACAATG
TCTGCCTCGAGTAGATTTTTCCCTACGCCTTCGCGCCCCACGACTCGTCGTACAAGGCAATCCTCTCCGCCTCCA
GCCAAACGCCAACGCACGCCTGAATCGTGGACTGCCAAGAATCCAGACTGGCAAAAGGCTTGGAAAAGCTCGCTC
GTGTTTCCAGCCACTGGGAAGAATAGAGCAACTGTGGATGCTGATGACATTGTTCGTCTTGACGAGGGCCAGCTG
CTTAATGACAATTTGCTGGCTTTCTATTTGCGCTATCTTGAGCATAAGCTCGAAGTCCAAAATTCAGAAGCACAA
AGCAAGGTTTACATTTTCAGCACTTTCTTCTATGAGAAGCTGCGTTCCACAAGGAGTAAGATCAACTATGAGGGG
GTCAAGACTTGGACCGCCAAGATTGACCTTTTTTCCTATGACTATGTCATTGTTCCGGTCAACGAAAGCGCACAC
TGGTATCTTGCCATAATTTGCAACCTGCCCAACACGCTCAAGAATTGCAACAAGAATGACGACGAGAGTGGTGGT
GCGCGCATGGTTGATGTAATGCTTCCCAAAATCATCACTCTCGACTCTCTAGGCCAACAGCGCTCAGCCGCTTGC
AGATGTCTGAGGGAATATCTTGTTGAGGAGGCCAGACATAAAAAGGGAGTCGACTTGGTCACGATTCCTAATGGG
ATGACGGCCAAGTCGTTGCCTGAGCAAGGCAACGGCTCAGATTGCGGCGTCTATCTACTCGCCTACACAGAGCAG
TTTCTAAACAACCCCGAGGAATGCTGTCGCAAACTCTATCAAAAGGAAAACCTTGGGTGGAAAGTTGACTCGTGT
CAGCTGCGGTCTGACATACGCACTCTGATACTGAGATTGCAACAGGAGCAGCAGCAGGCACCGGCCAAGAAAAAG
CAAAAACGAGTGGAGAGTAAGCTTGCCTCGATGGGCATGTCTGGCCAGAAACAAGGCCAAGATGCAAACTCTCGT
AGTCTTGAGGATTTGCCGACAATACCCAAGATTTCATGCAAAGATGCAGCACCAGAATGTGTCGAGTCACGAGGA
GAAGCGAAGCCACGGCAGACTCCCAAGGCAAATGATGTCGTGGAGTCTCCACAGGTTGTCAAAGCACATGGTGTC
GCCAAGCCACCAGAGACTGCTACTTCACATGGTGTTGTCAATTCACTAGAGCTTGTTGAAGTACGCCATGATGCC
GTTCAATCACAACACAAGGCCGAGTCACCACAGATTATCGAATCACCAGACGGCACCAAGTCTTTGAAAGCCTCC
GTGTCCAATGCAATCAAGACGAGTAACTCTAATTCTTCAAGAGGCGCCAGCACGGCGACAAATGGGGTACAGTCG
CGAATCCATCAGCCCCCGGGCGCTGCCCCTGGAGCAACACTGAACCCCCGGGCTGAGAGTGCGGCACAAGCAACA
GATGTACTTTACAATGGCGACGACGATGTTAAACTCATTAGCTGTATTAAGAGCAGTTCAAGTCCCAGCACAGAG
TCTTGCAACTCCATCTATCATTCTGCACAGTCTTCCCCAACGAGACAATTACGACTAGATAAAGCCGATACTGCT
TCCAAGTCAGCAACGGCAAAGAAGAAGAAGAAGCCATTTAGCGCCTTGCCAATCGTGTCAGTTGAAGATTCCAAC
TCGTCGCACCGCGTGTCGACGATACTCAGTTCACCCGAGCCCGACTTTGAAATCATTAAGGATGAAGCAGCAAAG
GCGAACTTGCGTAAACGACACTTGGAACGCCACGGCAAAGAGAGCAAACGTGCACCAAAATCTCTTGACATTCCA
GATGCGAAGAGACATTGTGCAAGATATGAAGGCGTGAGCAGGGCGAATAATGGTGGAGTGATATAA
Transcript >OphauB2|5529
ATGTCCGCATCCGTGCATGGCCAACCTCCTCCTTCGCAGCAGCAGCAGCGCCACAACGGCTCGGGCCCGAACAGA
TTACCTCGCAGCGACAACGTCATCCTGCTGAGCGACGAGGACTCGGACTCGGACTCGAGGCAGGCCCTTGACCAG
GCAAAGCCCACCTGTGGCGGGAGCGACAAGCCAGCAGGGGAAGCTACTCAACGGCAAGGGCCTTTGGACTCGTCC
CATCATGAGAGCGAGACCATGGGCAAATATCGCATGAATATTATCAACAAGACCGCCGTGTGCCCCGTCAACACC
TTGAGCAGAAAAGACACAAAATCTTCGCATACCTCATCTTTGAGCGCCAAGTCGTGCGCTTCACAAGGATCCAGG
GCTGTAGCTTCCCTAAGACTCGAAAGAAAAACCTCCTTGTCGACACAGCCCGAGATCCACGATCTCACCGGCCCC
TCACGGACCGGCGTCACAGTCACCCCAGAGGCGGCCGATTGCGACTCTTTTGAGGTACCAGAATGGCATTTGCGT
CTGGTTCCTGGTAGACGAGAATCCAAGTCTCATGGTATCCGACTGGCGTCTTCAGTAACAAAAACCCCTTCAAAA
GTCAAAGGCAGTAACACAGATGCGACTAAACAGGCTCTGTTTAAACCCTGGAACCGCCAAAAAGAAAGTCCTGAT
ATTCTGTCCTGCGACGACCCCCCAGCGGCGCGTGTTGAGTCAGACTTGCTGCTGCACAGCCCACTTGGCCAGAGA
GGCATACTGGCCAACTCTGAGCAGAAGCAGAAACTTGGCTCTTTGAAGCGCCATGGAGCGCTTGAAGGCAAGGAG
AGACTCGATTCTGAAGATGAATTAGGGGCAGAACCGAAGCGCTTGGGCAAACGTGATACCAACTTTGCCCATGTA
GGCAATCCGAGGCAAACACGCATGCGAAACCGCGAGATTCATTCCTCCGACTTTACTACCGACCGTCAAACCCAA
TCTCTGCATGTCATCAAAGCAGTTTGTGGAAGCGTAATGTATACACAACAAGGAAATCGCGCTGTAAGGCTCGAG
AGGAGAGACCCTGGGAAACCTCTGCTGGTGCCAGTCAATGAATCCGGCAAGGAAATTGGCCATCTCAAATGGATG
GGCATCGACTTGAGTTCCATCAAGAGTTTGGAGCGTTCCGAGCCCAACGCACATGGTGCTTTTGTCGTTATACAT
CGACCCAAGACGCACGACGCCATGAGCCAGCTCTGCCTCGAGTTTGAGCCTTCAAGTAATCTCTCAGTCCTCAGC
GGGAAAATTACAGATTCTTTAAAACTTGAACGCATTGTGAAGAAGGCTTTTAAGGATGCACAATTGCGGCAGCTC
TCCCACAAGAACCATGGCTCGACCAAGGACGACTCTCAGCCAACACCATGGCTACCAAATACATCGGCCGATACG
ATTAATGGAACCAAAAATCAGGATGCGCCCAAGCAACATGAAGGCCTGGTTAGTAAGATGCGAAGTGCAGCCCAG
AAAACGACTGGTAAGGAGGAAGCTGTCAAGGCAATCAAGTCACCTCTTGTATCAGACAAGGCCAGTCCGACAATG
TCTGCCTCGAGTAGATTTTTCCCTACGCCTTCGCGCCCCACGACTCGTCGTACAAGGCAATCCTCTCCGCCTCCA
GCCAAACGCCAACGCACGCCTGAATCGTGGACTGCCAAGAATCCAGACTGGCAAAAGGCTTGGAAAAGCTCGCTC
GTGTTTCCAGCCACTGGGAAGAATAGAGCAACTGTGGATGCTGATGACATTGTTCGTCTTGACGAGGGCCAGCTG
CTTAATGACAATTTGCTGGCTTTCTATTTGCGCTATCTTGAGCATAAGCTCGAAGTCCAAAATTCAGAAGCACAA
AGCAAGGTTTACATTTTCAGCACTTTCTTCTATGAGAAGCTGCGTTCCACAAGGAGTAAGATCAACTATGAGGGG
GTCAAGACTTGGACCGCCAAGATTGACCTTTTTTCCTATGACTATGTCATTGTTCCGGTCAACGAAAGCGCACAC
TGGTATCTTGCCATAATTTGCAACCTGCCCAACACGCTCAAGAATTGCAACAAGAATGACGACGAGAGTGGTGGT
GCGCGCATGGTTGATGTAATGCTTCCCAAAATCATCACTCTCGACTCTCTAGGCCAACAGCGCTCAGCCGCTTGC
AGATGTCTGAGGGAATATCTTGTTGAGGAGGCCAGACATAAAAAGGGAGTCGACTTGGTCACGATTCCTAATGGG
ATGACGGCCAAGTCGTTGCCTGAGCAAGGCAACGGCTCAGATTGCGGCGTCTATCTACTCGCCTACACAGAGCAG
TTTCTAAACAACCCCGAGGAATGCTGTCGCAAACTCTATCAAAAGGAAAACCTTGGGTGGAAAGTTGACTCGTGT
CAGCTGCGGTCTGACATACGCACTCTGATACTGAGATTGCAACAGGAGCAGCAGCAGGCACCGGCCAAGAAAAAG
CAAAAACGAGTGGAGAGTAAGCTTGCCTCGATGGGCATGTCTGGCCAGAAACAAGGCCAAGATGCAAACTCTCGT
AGTCTTGAGGATTTGCCGACAATACCCAAGATTTCATGCAAAGATGCAGCACCAGAATGTGTCGAGTCACGAGGA
GAAGCGAAGCCACGGCAGACTCCCAAGGCAAATGATGTCGTGGAGTCTCCACAGGTTGTCAAAGCACATGGTGTC
GCCAAGCCACCAGAGACTGCTACTTCACATGGTGTTGTCAATTCACTAGAGCTTGTTGAAGTACGCCATGATGCC
GTTCAATCACAACACAAGGCCGAGTCACCACAGATTATCGAATCACCAGACGGCACCAAGTCTTTGAAAGCCTCC
GTGTCCAATGCAATCAAGACGAGTAACTCTAATTCTTCAAGAGGCGCCAGCACGGCGACAAATGGGGTACAGTCG
CGAATCCATCAGCCCCCGGGCGCTGCCCCTGGAGCAACACTGAACCCCCGGGCTGAGAGTGCGGCACAAGCAACA
GATGTACTTTACAATGGCGACGACGATGTTAAACTCATTAGCTGTATTAAGAGCAGTTCAAGTCCCAGCACAGAG
TCTTGCAACTCCATCTATCATTCTGCACAGTCTTCCCCAACGAGACAATTACGACTAGATAAAGCCGATACTGCT
TCCAAGTCAGCAACGGCAAAGAAGAAGAAGAAGCCATTTAGCGCCTTGCCAATCGTGTCAGTTGAAGATTCCAAC
TCGTCGCACCGCGTGTCGACGATACTCAGTTCACCCGAGCCCGACTTTGAAATCATTAAGGATGAAGCAGCAAAG
GCGAACTTGCGTAAACGACACTTGGAACGCCACGGCAAAGAGAGCAAACGTGCACCAAAATCTCTTGACATTCCA
GATGCGAAGAGACATTGTGCAAGATATGAAGGCGTGAGCAGGGCGAATAATGGTGGAGTGATATAA
Gene >OphauB2|5529
ATGTCCGCATCCGTGCATGGCCAACCTCCTCCTTCGCAGCAGCAGCAGCGCCACAACGGCTCGGGCCCGAACAGG
TATTGGTCTGGCACCTTTGCAAAGAGGATTTGCAGAAGCTGACTCGAGGATATGTCAGATTACCTCGCAGCGACA
ACGTCATCCTGCTGAGCGACGAGGACTCGGACTCGGACTCGAGGCAGGCCCTTGACCAGGCAAAGCCCACCTGTG
GCGGGAGCGACAAGCCAGCAGGGGAAGCTACTCAACGGCAAGGGCCTTTGGACTCGTCCCATCATGAGAGCGAGA
CCATGGGCAAATATCGCATGGTGACTATCGTCTACAAGGGTTTGCCACTGTGCATCTGCTTGAGTCTGACTCTCC
TGGCAGAATATTATCAACAAGACCGCCGTGTGCCCCGTCAACACCTTGAGCAGAAAAGACACAAAATCTTCGCAT
ACCTCATCTTTGAGCGCCAAGTCGTGCGCTTCACAAGGATCCAGGGCTGTAGCTTCCCTAAGACTCGAAAGAAAA
ACCTCCTTGTCGACACAGCCCGAGATCCACGATCTCACCGGCCCCTCACGGACCGGCGTCACAGTCACCCCAGAG
GCGGCCGATTGCGACTCTTTTGAGGTACCAGAATGGCATTTGCGTCTGGTTCCTGGTAGACGAGAATCCAAGTCT
CATGGTATCCGACTGGCGTCTTCAGTAACAAAAACCCCTTCAAAAGTCAAAGGCAGTAACACAGATGCGACTAAA
CAGGCTCTGTTTAAACCCTGGAACCGCCAAAAAGAAAGTCCTGATATTCTGTCCTGCGACGACCCCCCAGCGGCG
CGTGTTGAGTCAGACTTGCTGCTGCACAGCCCACTTGGCCAGAGAGGCATACTGGCCAACTCTGAGCAGAAGCAG
AAACTTGGCTCTTTGAAGCGCCATGGAGCGCTTGAAGGCAAGGAGAGACTCGATTCTGAAGATGAATTAGGGGCA
GAACCGAAGCGCTTGGGCAAACGTGATACCAACTTTGCCCATGTAGGCAATCCGAGGCAAACACGCATGCGAAAC
CGCGAGATTCATTCCTCCGACTTTACTACCGACCGTCAAACCCAATCTCTGCATGTCATCAAAGCAGTTTGTGGA
AGCGTAATGTATACACAACAAGGAAATCGCGCTGTAAGGCTCGAGAGGAGAGACCCTGGGAAACCTCTGCTGGTG
CCAGTCAATGAATCCGGCAAGGAAATTGGCCATCTCAAATGGATGGGCATCGACTTGAGTTCCATCAAGAGTTTG
GAGCGTTCCGAGCCCAACGCACATGGTGCTTTTGTCGTTATACATCGACCCAAGACGCACGACGCCATGAGCCAG
CTCTGCCTCGAGTTTGAGCCTTCAAGTAATCTCTCAGTCCTCAGCGGGAAAATTACAGATTCTTTGTTGGTCACT
CACCATGCAGCAAAATGGTGTTGGGCTAATCTTGTACAGAAAACTTGAACGCATTGTGAAGAAGGCTTTTAAGGA
TGCACAATTGCGGCAGCTCTCCCACAAGAACCATGGCTCGACCAAGGACGACTCTCAGCCAACACCATGGCTACC
AAATACATCGGCCGATACGATTAATGGAACCAAAAATCAGGATGCGCCCAAGCAACATGAAGGCCTGGTTAGTAA
GATGCGAAGTGCAGCCCAGAAAACGACTGGTAAGGAGGAAGCTGTCAAGGCAATCAAGTCACCTCTTGTATCAGA
CAAGGCCAGTCCGACAATGTCTGCCTCGAGTAGATTTTTCCCTACGCCTTCGCGCCCCACGACTCGTCGTACAAG
GCAATCCTCTCCGCCTCCAGCCAAACGCCAACGCACGCCTGAATCGTGGACTGCCAAGAATCCAGACTGGCAAAA
GGCTTGGAAAAGCTCGCTCGTGTTTCCAGCCACTGGGAAGAATAGAGCAACTGTGGATGCTGATGACATTGTTCG
TCTTGACGAGGGCCAGCTGCTTAATGACAATTTGCTGGCTTTCTATTTGCGCTATCTTGAGCATAAGCTCGAAGT
CCAAAATTCAGAAGCACAAAGCAAGGTTTACATTTTCAGCACTTTCTTCTATGAGAAGCTGCGTTCCACAAGGAG
TAAGATCAACTATGAGGGGGTCAAGACTTGGACCGCCAAGATTGACCTTTTTTCCTATGACTATGTCATTGTTCC
GGTCAACGAAAGCGCACACTGGTATCTTGCCATAATTTGCAACCTGCCCAACACGCTCAAGAATTGCAACAAGAA
TGACGACGAGAGTGGTGGTGCGCGCATGGTTGATGTAATGCTTCCCAAAATCATCACTCTCGACTCTCTAGGCCA
ACAGCGCTCAGCCGCTTGCAGATGTCTGAGGGAATATCTTGTTGAGGAGGCCAGACATAAAAAGGGAGTCGACTT
GGTCACGATTCCTAATGGGATGACGGCCAAGTCGTTGCCTGAGCAAGGCAACGGCTCAGATTGCGGCGTCTATCT
ACTCGCCTACACAGAGCAGTTTCTAAACAACCCCGAGGAATGCTGTCGCAAACTCTATCAAAAGGAAAACCTTGG
GTGGAAAGTTGACTCGTGTCAGCTGCGGTCTGACATACGCACTCTGATACTGAGATTGCAACAGGAGCAGCAGCA
GGCACCGGCCAAGAAAAAGCAAAAACGAGTGGAGAGTAAGCTTGCCTCGATGGGCATGTCTGGCCAGAAACAAGG
CCAAGATGCAAACTCTCGTAGTCTTGAGGATTTGCCGACAATACCCAAGATTTCATGCAAAGATGCAGCACCAGA
ATGTGTCGAGTCACGAGGAGAAGCGAAGCCACGGCAGACTCCCAAGGCAAATGATGTCGTGGAGTCTCCACAGGT
TGTCAAAGCACATGGTGTCGCCAAGCCACCAGAGACTGCTACTTCACATGGTGTTGTCAATTCACTAGAGCTTGT
TGAAGTACGCCATGATGCCGTTCAATCACAACACAAGGCCGAGTCACCACAGATTATCGAATCACCAGACGGCAC
CAAGTCTTTGAAAGCCTCCGTGTCCAATGCAATCAAGACGAGTAACTCTAATTCTTCAAGAGGCGCCAGCACGGC
GACAAATGGGGTACAGTCGCGAATCCATCAGCCCCCGGGCGCTGCCCCTGGAGCAACACTGAACCCCCGGGCTGA
GAGTGCGGCACAAGCAACAGATGTACTTTACAATGGCGACGACGATGTTAAACTCATTAGCTGTATTAAGAGCAG
TTCAAGTCCCAGCACAGAGTCTTGCAACTCCATCTATCATTCTGCACAGTCTTCCCCAACGAGACAATTACGACT
AGATAAAGCCGATACTGCTTCCAAGTCAGCAACGGCAAAGAAGAAGAAGAAGCCATTTAGCGCCTTGCCAATCGT
GTCAGTTGAAGATTCCAACTCGTCGCACCGCGTGTCGACGATACTCAGTTCACCCGAGCCCGACTTTGAAATCAT
TAAGGATGAAGCAGCAAAGGCGAACTTGCGTAAACGACACTTGGAACGCCACGGCAAAGAGAGCAAACGTGCACC
AAAATCTCTTGACATTCCAGATGCGAAGAGACATTGTGCAAGATATGAAGGCGTGAGCAGGGCGAATAATGGTGG
AGTGATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail