Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5528
Gene name
LocationContig_43:90483..92484
Strand-
Gene length (bp)2001
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 3.7E-35 154 632

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 189 505 2.0E-29
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 148 551 6.0E-16
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 154 577 5.0E-13
sp|A2BGT0|UBP30_DANRE Ubiquitin carboxyl-terminal hydrolase 30 OS=Danio rerio GN=usp30 PE=3 SV=1 154 644 6.0E-13
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 153 637 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 189 505 2.0E-29
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 148 551 6.0E-16
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 154 577 5.0E-13
sp|A2BGT0|UBP30_DANRE Ubiquitin carboxyl-terminal hydrolase 30 OS=Danio rerio GN=usp30 PE=3 SV=1 154 644 6.0E-13
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 153 637 3.0E-11
sp|D3ZPG5|UBP30_RAT Ubiquitin carboxyl-terminal hydrolase 30 OS=Rattus norvegicus GN=Usp30 PE=3 SV=1 154 370 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0070646 protein modification by small protein removal No
GO:0140096 catalytic activity, acting on a protein No
GO:0036211 protein modification process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0008234 cysteine-type peptidase activity No
GO:0008152 metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 61 83 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5528
MNQPQDEFGSFYEAQITARRHSLPRERFSTPWSEASVLISILALLVPLLIKLYGSEARFASIVGSILGLLGDVVT
FVLPGRLLLAIDARMNPSCLADGQGSHLHHAAKKDALRRILGLDQAHGLMESVFQARNRALSVTGGMLGLKPDAQ
RPAGLGNLDNSCYQNSILQGLAALESFPDYLEACARIVETSQAANNEVAQTLAMLIDDLNDLSNNNKTIWTPRLL
KSMSTWTQQDAQEYFSKIVEDIDKSVADRIKETQPHPGIGVECYKDEAVASLHSDDSGYQSLSWHTDLSPLEGLR
NPLEGLLAQRVACVQCGHSEGLSMIPFNCLTLSLGLDKSQHDLYDRLDAFTRVETIEGVECAKCTLLKAQKLLGK
LLDKMQQGTAGPGLGQEQVDEARRRLEAVEEALEQDLFDDKTLLDKCRITAQSKMSSAKTKQIVVARPPRSLVVH
INRSVFDPATFDMMKNSAPVGFPLTFDLGPWCLGSNSSRTSKGGEAGQAGGEEQELWQLDAKTSMISSDEKRSRL
TGPLYELRAVVTHAGRHENGHYICYRRYPKARTRGRGGRVAWKRFAGAAVENGEGQDESSRATQMQQACDAGVEE
KAQWWRLSDDNVIEVDEEIVQRQASGVFMLFYECVERDMVLSEEGGEEQQIMGAPERDGEAQAQDD*
Coding >OphauB2|5528
ATGAATCAGCCACAGGACGAGTTTGGAAGCTTTTATGAGGCTCAAATCACGGCTCGTCGCCATTCGTTGCCGCGC
GAGCGCTTCTCGACTCCGTGGAGCGAAGCTAGTGTGCTCATTTCGATTCTTGCATTGCTAGTGCCGCTCCTCATC
AAGCTCTACGGCTCGGAAGCAAGATTTGCCAGCATTGTGGGCTCGATACTTGGCCTGCTTGGCGACGTGGTGACC
TTTGTTTTACCGGGAAGACTGTTGCTTGCCATTGACGCCCGGATGAATCCCTCGTGCTTGGCTGACGGACAAGGT
TCGCATCTACACCATGCCGCCAAAAAGGACGCGCTGAGGAGAATCCTCGGCTTGGATCAGGCCCATGGCTTGATG
GAGTCGGTCTTTCAGGCACGCAATCGAGCGCTTTCGGTGACGGGGGGCATGCTGGGCTTGAAGCCGGATGCCCAG
CGTCCTGCCGGTCTCGGCAACCTGGACAATTCGTGCTATCAAAACAGTATTTTGCAGGGCCTGGCCGCCCTTGAA
TCCTTCCCCGACTACCTCGAAGCGTGTGCAAGAATTGTTGAAACAAGCCAAGCGGCAAACAATGAGGTTGCCCAG
ACACTGGCCATGCTAATTGATGACTTGAACGACTTGTCAAACAATAACAAGACGATATGGACCCCTAGACTTCTC
AAGTCGATGAGCACATGGACACAGCAGGATGCACAAGAGTACTTTTCAAAGATTGTCGAAGACATTGACAAGAGC
GTGGCGGATAGGATCAAGGAGACGCAACCGCATCCCGGAATAGGGGTAGAGTGCTACAAAGACGAAGCTGTGGCT
AGTCTACACAGCGATGACAGCGGATACCAAAGTTTGTCGTGGCATACAGATCTTTCGCCGCTAGAAGGATTACGG
AATCCGCTCGAAGGCTTGCTGGCGCAACGAGTGGCGTGTGTGCAGTGCGGCCACTCGGAAGGGCTATCCATGATT
CCCTTCAACTGCCTCACGTTGAGTCTGGGCCTGGACAAGAGCCAACACGACCTGTATGACCGGCTAGACGCCTTT
ACACGAGTCGAGACGATTGAGGGCGTTGAATGTGCCAAGTGCACCTTGCTCAAGGCACAAAAGCTCCTGGGCAAA
CTGCTGGACAAGATGCAGCAGGGGACGGCAGGGCCAGGTCTGGGACAAGAGCAGGTGGACGAGGCGCGACGTCGA
CTCGAAGCCGTGGAGGAAGCGCTTGAGCAAGACTTGTTTGACGACAAGACGCTTTTGGACAAGTGCAGAATTACG
GCGCAAAGCAAGATGAGTTCGGCCAAGACGAAGCAGATTGTTGTTGCTCGGCCACCGCGAAGCCTGGTGGTTCAC
ATCAACCGGTCTGTGTTTGACCCGGCCACGTTTGACATGATGAAGAACTCGGCTCCTGTTGGCTTTCCACTAACC
TTTGACCTGGGGCCTTGGTGTCTGGGAAGCAACTCTAGCCGTACCAGCAAGGGAGGCGAGGCAGGCCAAGCGGGT
GGCGAGGAGCAGGAACTGTGGCAACTGGATGCAAAGACATCAATGATATCGAGTGACGAGAAACGGTCTCGCCTT
ACGGGACCCTTGTACGAGCTACGAGCAGTCGTGACACATGCCGGGCGACATGAAAACGGGCATTATATTTGCTAT
CGAAGATACCCGAAAGCAAGGACAAGGGGACGAGGTGGAAGGGTGGCATGGAAGAGATTTGCAGGCGCTGCTGTG
GAAAATGGCGAGGGCCAAGACGAGAGTAGTCGGGCGACACAAATGCAACAAGCATGTGACGCCGGGGTGGAGGAA
AAGGCGCAGTGGTGGAGGCTGAGCGACGACAACGTTATCGAGGTGGACGAGGAAATAGTGCAGAGGCAGGCATCG
GGAGTTTTTATGCTGTTTTACGAGTGTGTTGAGCGCGACATGGTACTGAGTGAGGAGGGTGGTGAGGAGCAGCAG
ATTATGGGGGCGCCCGAGAGGGACGGCGAGGCGCAGGCGCAAGACGATTGA
Transcript >OphauB2|5528
ATGAATCAGCCACAGGACGAGTTTGGAAGCTTTTATGAGGCTCAAATCACGGCTCGTCGCCATTCGTTGCCGCGC
GAGCGCTTCTCGACTCCGTGGAGCGAAGCTAGTGTGCTCATTTCGATTCTTGCATTGCTAGTGCCGCTCCTCATC
AAGCTCTACGGCTCGGAAGCAAGATTTGCCAGCATTGTGGGCTCGATACTTGGCCTGCTTGGCGACGTGGTGACC
TTTGTTTTACCGGGAAGACTGTTGCTTGCCATTGACGCCCGGATGAATCCCTCGTGCTTGGCTGACGGACAAGGT
TCGCATCTACACCATGCCGCCAAAAAGGACGCGCTGAGGAGAATCCTCGGCTTGGATCAGGCCCATGGCTTGATG
GAGTCGGTCTTTCAGGCACGCAATCGAGCGCTTTCGGTGACGGGGGGCATGCTGGGCTTGAAGCCGGATGCCCAG
CGTCCTGCCGGTCTCGGCAACCTGGACAATTCGTGCTATCAAAACAGTATTTTGCAGGGCCTGGCCGCCCTTGAA
TCCTTCCCCGACTACCTCGAAGCGTGTGCAAGAATTGTTGAAACAAGCCAAGCGGCAAACAATGAGGTTGCCCAG
ACACTGGCCATGCTAATTGATGACTTGAACGACTTGTCAAACAATAACAAGACGATATGGACCCCTAGACTTCTC
AAGTCGATGAGCACATGGACACAGCAGGATGCACAAGAGTACTTTTCAAAGATTGTCGAAGACATTGACAAGAGC
GTGGCGGATAGGATCAAGGAGACGCAACCGCATCCCGGAATAGGGGTAGAGTGCTACAAAGACGAAGCTGTGGCT
AGTCTACACAGCGATGACAGCGGATACCAAAGTTTGTCGTGGCATACAGATCTTTCGCCGCTAGAAGGATTACGG
AATCCGCTCGAAGGCTTGCTGGCGCAACGAGTGGCGTGTGTGCAGTGCGGCCACTCGGAAGGGCTATCCATGATT
CCCTTCAACTGCCTCACGTTGAGTCTGGGCCTGGACAAGAGCCAACACGACCTGTATGACCGGCTAGACGCCTTT
ACACGAGTCGAGACGATTGAGGGCGTTGAATGTGCCAAGTGCACCTTGCTCAAGGCACAAAAGCTCCTGGGCAAA
CTGCTGGACAAGATGCAGCAGGGGACGGCAGGGCCAGGTCTGGGACAAGAGCAGGTGGACGAGGCGCGACGTCGA
CTCGAAGCCGTGGAGGAAGCGCTTGAGCAAGACTTGTTTGACGACAAGACGCTTTTGGACAAGTGCAGAATTACG
GCGCAAAGCAAGATGAGTTCGGCCAAGACGAAGCAGATTGTTGTTGCTCGGCCACCGCGAAGCCTGGTGGTTCAC
ATCAACCGGTCTGTGTTTGACCCGGCCACGTTTGACATGATGAAGAACTCGGCTCCTGTTGGCTTTCCACTAACC
TTTGACCTGGGGCCTTGGTGTCTGGGAAGCAACTCTAGCCGTACCAGCAAGGGAGGCGAGGCAGGCCAAGCGGGT
GGCGAGGAGCAGGAACTGTGGCAACTGGATGCAAAGACATCAATGATATCGAGTGACGAGAAACGGTCTCGCCTT
ACGGGACCCTTGTACGAGCTACGAGCAGTCGTGACACATGCCGGGCGACATGAAAACGGGCATTATATTTGCTAT
CGAAGATACCCGAAAGCAAGGACAAGGGGACGAGGTGGAAGGGTGGCATGGAAGAGATTTGCAGGCGCTGCTGTG
GAAAATGGCGAGGGCCAAGACGAGAGTAGTCGGGCGACACAAATGCAACAAGCATGTGACGCCGGGGTGGAGGAA
AAGGCGCAGTGGTGGAGGCTGAGCGACGACAACGTTATCGAGGTGGACGAGGAAATAGTGCAGAGGCAGGCATCG
GGAGTTTTTATGCTGTTTTACGAGTGTGTTGAGCGCGACATGGTACTGAGTGAGGAGGGTGGTGAGGAGCAGCAG
ATTATGGGGGCGCCCGAGAGGGACGGCGAGGCGCAGGCGCAAGACGATTGA
Gene >OphauB2|5528
ATGAATCAGCCACAGGACGAGTTTGGAAGCTTTTATGAGGCTCAAATCACGGCTCGTCGCCATTCGTTGCCGCGC
GAGCGCTTCTCGACTCCGTGGAGCGAAGCTAGTGTGCTCATTTCGATTCTTGCATTGCTAGTGCCGCTCCTCATC
AAGCTCTACGGCTCGGAAGCAAGATTTGCCAGCATTGTGGGCTCGATACTTGGCCTGCTTGGCGACGTGGTGACC
TTTGTTTTACCGGGAAGACTGTTGCTTGCCATTGACGCCCGGATGAATCCCTCGTGCTTGGCTGACGGACAAGGT
TCGCATCTACACCATGCCGCCAAAAAGGACGCGCTGAGGAGAATCCTCGGCTTGGATCAGGCCCATGGCTTGATG
GAGTCGGTCTTTCAGGCACGCAATCGAGCGCTTTCGGTGACGGGGGGCATGCTGGGCTTGAAGCCGGATGCCCAG
CGTCCTGCCGGTCTCGGCAACCTGGACAATTCGTGCTATCAAAACAGTATTTTGCAGGGCCTGGCCGCCCTTGAA
TCCTTCCCCGACTACCTCGAAGCGTGTGCAAGAATTGTTGAAACAAGCCAAGCGGCAAACAATGAGGTTGCCCAG
ACACTGGCCATGCTAATTGATGACTTGAACGACTTGTCAAACAATAACAAGACGATATGGACCCCTAGACTTCTC
AAGTCGATGAGCACATGGACACAGCAGGATGCACAAGAGTACTTTTCAAAGATTGTCGAAGACATTGACAAGAGC
GTGGCGGATAGGATCAAGGAGACGCAACCGCATCCCGGAATAGGGGTAGAGTGCTACAAAGACGAAGCTGTGGCT
AGTCTACACAGCGATGACAGCGGATACCAAAGTTTGTCGTGGCATACAGATCTTTCGCCGCTAGAAGGATTACGG
AATCCGCTCGAAGGCTTGCTGGCGCAACGAGTGGCGTGTGTGCAGTGCGGCCACTCGGAAGGGCTATCCATGATT
CCCTTCAACTGCCTCACGTTGAGTCTGGGCCTGGACAAGAGCCAACACGACCTGTATGACCGGCTAGACGCCTTT
ACACGAGTCGAGACGATTGAGGGCGTTGAATGTGCCAAGTGCACCTTGCTCAAGGCACAAAAGCTCCTGGGCAAA
CTGCTGGACAAGATGCAGCAGGGGACGGCAGGGCCAGGTCTGGGACAAGAGCAGGTGGACGAGGCGCGACGTCGA
CTCGAAGCCGTGGAGGAAGCGCTTGAGCAAGACTTGTTTGACGACAAGACGCTTTTGGACAAGTGCAGAATTACG
GCGCAAAGCAAGATGAGTTCGGCCAAGACGAAGCAGATTGTTGTTGCTCGGCCACCGCGAAGCCTGGTGGTTCAC
ATCAACCGGTCTGTGTTTGACCCGGCCACGTTTGACATGATGAAGAACTCGGCTCCTGTTGGCTTTCCACTAACC
TTTGACCTGGGGCCTTGGTGTCTGGGAAGCAACTCTAGCCGTACCAGCAAGGGAGGCGAGGCAGGCCAAGCGGGT
GGCGAGGAGCAGGAACTGTGGCAACTGGATGCAAAGACATCAATGATATCGAGTGACGAGAAACGGTCTCGCCTT
ACGGGACCCTTGTACGAGCTACGAGCAGTCGTGACACATGCCGGGCGACATGAAAACGGGCATTATATTTGCTAT
CGAAGATACCCGAAAGCAAGGACAAGGGGACGAGGTGGAAGGGTGGCATGGAAGAGATTTGCAGGCGCTGCTGTG
GAAAATGGCGAGGGCCAAGACGAGAGTAGTCGGGCGACACAAATGCAACAAGCATGTGACGCCGGGGTGGAGGAA
AAGGCGCAGTGGTGGAGGCTGAGCGACGACAACGTTATCGAGGTGGACGAGGAAATAGTGCAGAGGCAGGCATCG
GGAGTTTTTATGCTGTTTTACGAGTGTGTTGAGCGCGACATGGTACTGAGTGAGGAGGGTGGTGAGGAGCAGCAG
ATTATGGGGGCGCCCGAGAGGGACGGCGAGGCGCAGGCGCAAGACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail