Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5519
Gene name
LocationContig_43:59997..61194
Strand-
Gene length (bp)1197
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60024|ALL4_ASPFU Allergen Asp f 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03830 PE=1 SV=2 191 398 3.0E-19

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5300
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2018
Ophiocordyceps australis map64 (Brazil) OphauB2|5519 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05565
Ophiocordyceps camponoti-rufipedis Ophun1|4944
Ophiocordyceps kimflemingae Ophio5|4446
Ophiocordyceps subramaniannii Hirsu2|4791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5519
MKISTTSLVLAGALGAVAHPSRHAHRLAHRSLDRRTDFVRAAKPEDVPPVVEEIEYVTYTETTWVLASDATEAPV
AETTAAQAAVTFSTIAQVAAPSSAVVPMPAPLAPQVPQAPQAPQPPQNLVVPPSSSVVAAPATSVAAPAPASNSG
SKSGAKSDSSSDSSSGSGVGASMYQPFCGGKAHKRATIEQIAYKGNVGSTEYGCNMKLVQSQIADKYDYTLRFHN
AGDQNQKCICWLKIGPDNGINGFFSNNDKAIKFDLPPGAEQYLAVDSDTQGGCTCDAGQVQTTKNGQWAGTWTEF
DAGNASNKKWSGADASCIVAAKERETDPNIRIPGMRVCDTVALDKAKRSEDAMNKHCSTIFNGGAGNNSYVGGTE
DLDGVGMNIQGTPVRLDVTVDYK*
Coding >OphauB2|5519
ATGAAGATTTCCACAACATCACTTGTTTTGGCCGGTGCCCTTGGCGCCGTTGCCCATCCCAGCCGTCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACAGACTTTGTCAGGGCTGCTAAGCCTGAGGACGTCCCCCCGGTT
GTCGAAGAGATTGAATACGTTACCTACACGGAGACTACCTGGGTTCTGGCTTCAGATGCCACCGAGGCTCCAGTA
GCAGAGACGACGGCTGCTCAGGCTGCTGTAACGTTTTCGACGATTGCTCAGGTTGCTGCACCCTCTTCTGCGGTT
GTCCCGATGCCAGCTCCTCTGGCTCCCCAAGTTCCCCAGGCTCCTCAAGCTCCCCAGCCTCCTCAGAATTTGGTT
GTGCCGCCGAGCTCCAGCGTCGTTGCAGCTCCTGCTACGTCGGTTGCCGCTCCGGCTCCTGCCTCCAACTCTGGG
TCCAAGTCTGGAGCTAAGTCTGATTCCAGCTCCGACTCTAGCTCGGGATCGGGCGTGGGTGCCAGCATGTATCAA
CCTTTTTGCGGTGGCAAGGCGCACAAGCGCGCCACGATTGAGCAGATTGCCTACAAGGGCAACGTTGGTTCCACT
GAATATGGCTGCAACATGAAGTTGGTGCAGAGCCAGATTGCCGACAAGTACGACTATACCCTCAGGTTCCACAAT
GCTGGTGACCAGAACCAGAAGTGCATCTGCTGGCTCAAGATTGGCCCCGACAATGGCATCAATGGCTTCTTTTCC
AACAACGACAAGGCCATCAAGTTTGATTTGCCCCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACACGCAG
GGTGGCTGCACCTGCGATGCTGGTCAGGTTCAGACGACCAAGAACGGCCAGTGGGCTGGCACCTGGACTGAATTC
GACGCTGGCAATGCGTCCAACAAGAAGTGGTCTGGTGCCGACGCCTCGTGCATCGTTGCTGCCAAGGAAAGGGAG
ACTGACCCCAACATTCGTATTCCCGGCATGAGGGTGTGCGACACGGTTGCACTGGACAAGGCCAAGCGATCTGAA
GACGCCATGAACAAGCATTGCTCCACCATCTTCAATGGTGGCGCAGGCAACAACTCTTATGTTGGCGGCACCGAG
GATCTTGACGGCGTTGGTATGAACATCCAAGGCACTCCTGTCCGCTTGGATGTCACAGTCGACTACAAGTAG
Transcript >OphauB2|5519
ATGAAGATTTCCACAACATCACTTGTTTTGGCCGGTGCCCTTGGCGCCGTTGCCCATCCCAGCCGTCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACAGACTTTGTCAGGGCTGCTAAGCCTGAGGACGTCCCCCCGGTT
GTCGAAGAGATTGAATACGTTACCTACACGGAGACTACCTGGGTTCTGGCTTCAGATGCCACCGAGGCTCCAGTA
GCAGAGACGACGGCTGCTCAGGCTGCTGTAACGTTTTCGACGATTGCTCAGGTTGCTGCACCCTCTTCTGCGGTT
GTCCCGATGCCAGCTCCTCTGGCTCCCCAAGTTCCCCAGGCTCCTCAAGCTCCCCAGCCTCCTCAGAATTTGGTT
GTGCCGCCGAGCTCCAGCGTCGTTGCAGCTCCTGCTACGTCGGTTGCCGCTCCGGCTCCTGCCTCCAACTCTGGG
TCCAAGTCTGGAGCTAAGTCTGATTCCAGCTCCGACTCTAGCTCGGGATCGGGCGTGGGTGCCAGCATGTATCAA
CCTTTTTGCGGTGGCAAGGCGCACAAGCGCGCCACGATTGAGCAGATTGCCTACAAGGGCAACGTTGGTTCCACT
GAATATGGCTGCAACATGAAGTTGGTGCAGAGCCAGATTGCCGACAAGTACGACTATACCCTCAGGTTCCACAAT
GCTGGTGACCAGAACCAGAAGTGCATCTGCTGGCTCAAGATTGGCCCCGACAATGGCATCAATGGCTTCTTTTCC
AACAACGACAAGGCCATCAAGTTTGATTTGCCCCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACACGCAG
GGTGGCTGCACCTGCGATGCTGGTCAGGTTCAGACGACCAAGAACGGCCAGTGGGCTGGCACCTGGACTGAATTC
GACGCTGGCAATGCGTCCAACAAGAAGTGGTCTGGTGCCGACGCCTCGTGCATCGTTGCTGCCAAGGAAAGGGAG
ACTGACCCCAACATTCGTATTCCCGGCATGAGGGTGTGCGACACGGTTGCACTGGACAAGGCCAAGCGATCTGAA
GACGCCATGAACAAGCATTGCTCCACCATCTTCAATGGTGGCGCAGGCAACAACTCTTATGTTGGCGGCACCGAG
GATCTTGACGGCGTTGGTATGAACATCCAAGGCACTCCTGTCCGCTTGGATGTCACAGTCGACTACAAGTAG
Gene >OphauB2|5519
ATGAAGATTTCCACAACATCACTTGTTTTGGCCGGTGCCCTTGGCGCCGTTGCCCATCCCAGCCGTCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACAGACTTTGTCAGGGCTGCTAAGCCTGAGGACGTCCCCCCGGTT
GTCGAAGAGATTGAATACGTTACCTACACGGAGACTACCTGGGTTCTGGCTTCAGATGCCACCGAGGCTCCAGTA
GCAGAGACGACGGCTGCTCAGGCTGCTGTAACGTTTTCGACGATTGCTCAGGTTGCTGCACCCTCTTCTGCGGTT
GTCCCGATGCCAGCTCCTCTGGCTCCCCAAGTTCCCCAGGCTCCTCAAGCTCCCCAGCCTCCTCAGAATTTGGTT
GTGCCGCCGAGCTCCAGCGTCGTTGCAGCTCCTGCTACGTCGGTTGCCGCTCCGGCTCCTGCCTCCAACTCTGGG
TCCAAGTCTGGAGCTAAGTCTGATTCCAGCTCCGACTCTAGCTCGGGATCGGGCGTGGGTGCCAGCATGTATCAA
CCTTTTTGCGGTGGCAAGGCGCACAAGCGCGCCACGATTGAGCAGATTGCCTACAAGGGCAACGTTGGTTCCACT
GAATATGGCTGCAACATGAAGTTGGTGCAGAGCCAGATTGCCGACAAGTACGACTATACCCTCAGGTTCCACAAT
GCTGGTGACCAGAACCAGAAGTGCATCTGCTGGCTCAAGATTGGCCCCGACAATGGCATCAATGGCTTCTTTTCC
AACAACGACAAGGCCATCAAGTTTGATTTGCCCCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACACGCAG
GGTGGCTGCACCTGCGATGCTGGTCAGGTTCAGACGACCAAGAACGGCCAGTGGGCTGGCACCTGGACTGAATTC
GACGCTGGCAATGCGTCCAACAAGAAGTGGTCTGGTGCCGACGCCTCGTGCATCGTTGCTGCCAAGGAAAGGGAG
ACTGACCCCAACATTCGTATTCCCGGCATGAGGGTGTGCGACACGGTTGCACTGGACAAGGCCAAGCGATCTGAA
GACGCCATGAACAAGCATTGCTCCACCATCTTCAATGGTGGCGCAGGCAACAACTCTTATGTTGGCGGCACCGAG
GATCTTGACGGCGTTGGTATGAACATCCAAGGCACTCCTGTCCGCTTGGATGTCACAGTCGACTACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail