Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5503
Gene name
LocationContig_43:22240..23086
Strand+
Gene length (bp)846
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08552 Kei1 Inositolphosphorylceramide synthase subunit Kei1 4.3E-49 16 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13994|KEI1_SCHPO Inositol phoshorylceramide synthase regulatory subunit kei1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kei1 PE=3 SV=1 15 233 3.0E-15
sp|Q06346|KEI1_YEAST Inositol phosphorylceramide synthase regulatory subunit KEI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEI1 PE=1 SV=2 14 207 2.0E-09

GO

GO Term Description Terminal node
GO:0070917 inositol phosphoceramide synthase regulator activity Yes
GO:0006673 inositol phosphoceramide metabolic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0098772 molecular function regulator activity No
GO:0019637 organophosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0030234 enzyme regulator activity No
GO:0006643 membrane lipid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 54 76 22
3 88 110 22
4 157 179 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5503
MSKFTRLYLRTPRPQSLFGLVGLQTGTELISLALVLNKVTGVYGLLAILTGYQLSLLQLSTYVYSIAVLGVLIYL
IPHIRRQSPFECLALAWIYLVDTVVNGACTAVLGLEWYFASTAAELAESGPPPSLPSIVTEGLEGLRREGEVHGK
VVPQETITSMLLVVGLTLIRVYFSVVVMAFARQVLRRHMQLRIVEGPEVDADGDEGPFAAHQPNGSGRRGRLGRF
MVSIGRGYWLDGSEMDGNWHRAPNGKGHVEGTLAGEV*
Coding >OphauB2|5503
ATGTCAAAGTTTACGAGGTTGTATTTGCGGACTCCTCGTCCACAGAGTCTTTTTGGATTGGTCGGCCTTCAGACA
GGAACAGAACTCATCTCGCTAGCCCTAGTCCTCAACAAAGTGACGGGAGTTTACGGCCTGTTGGCGATATTGACA
GGCTACCAACTGTCACTGCTGCAATTGTCCACATATGTCTACTCGATTGCGGTGCTTGGAGTTCTCATCTACTTG
ATCCCACACATTCGCCGACAGAGTCCGTTTGAATGTCTGGCATTGGCATGGATCTATCTAGTGGACACCGTCGTC
AACGGTGCCTGCACGGCTGTTCTTGGGCTCGAGTGGTATTTTGCCAGCACTGCGGCTGAATTGGCTGAGTCGGGG
CCGCCGCCATCTCTGCCGAGCATCGTGACCGAGGGCCTAGAGGGGCTGCGCCGAGAAGGCGAGGTGCACGGCAAA
GTAGTGCCACAAGAGACGATAACAAGCATGTTGTTGGTTGTGGGCTTGACCCTGATTCGCGTCTATTTTAGCGTC
GTCGTCATGGCTTTTGCGCGCCAGGTTTTGCGGAGACACATGCAGCTGCGGATCGTTGAAGGGCCCGAGGTGGAT
GCCGATGGAGATGAAGGTCCGTTTGCTGCGCACCAACCCAATGGGAGTGGCCGTAGGGGACGTCTAGGCAGATTC
ATGGTGTCGATAGGCCGTGGATACTGGCTCGACGGCAGCGAAATGGATGGGAACTGGCATAGGGCGCCAAACGGA
AAGGGCCATGTGGAAGGCACCCTGGCAGGAGAAGTTTAG
Transcript >OphauB2|5503
ATGTCAAAGTTTACGAGGTTGTATTTGCGGACTCCTCGTCCACAGAGTCTTTTTGGATTGGTCGGCCTTCAGACA
GGAACAGAACTCATCTCGCTAGCCCTAGTCCTCAACAAAGTGACGGGAGTTTACGGCCTGTTGGCGATATTGACA
GGCTACCAACTGTCACTGCTGCAATTGTCCACATATGTCTACTCGATTGCGGTGCTTGGAGTTCTCATCTACTTG
ATCCCACACATTCGCCGACAGAGTCCGTTTGAATGTCTGGCATTGGCATGGATCTATCTAGTGGACACCGTCGTC
AACGGTGCCTGCACGGCTGTTCTTGGGCTCGAGTGGTATTTTGCCAGCACTGCGGCTGAATTGGCTGAGTCGGGG
CCGCCGCCATCTCTGCCGAGCATCGTGACCGAGGGCCTAGAGGGGCTGCGCCGAGAAGGCGAGGTGCACGGCAAA
GTAGTGCCACAAGAGACGATAACAAGCATGTTGTTGGTTGTGGGCTTGACCCTGATTCGCGTCTATTTTAGCGTC
GTCGTCATGGCTTTTGCGCGCCAGGTTTTGCGGAGACACATGCAGCTGCGGATCGTTGAAGGGCCCGAGGTGGAT
GCCGATGGAGATGAAGGTCCGTTTGCTGCGCACCAACCCAATGGGAGTGGCCGTAGGGGACGTCTAGGCAGATTC
ATGGTGTCGATAGGCCGTGGATACTGGCTCGACGGCAGCGAAATGGATGGGAACTGGCATAGGGCGCCAAACGGA
AAGGGCCATGTGGAAGGCACCCTGGCAGGAGAAGTTTAG
Gene >OphauB2|5503
ATGTCAAAGTTTACGAGGTTGTATTTGCGGACTCCTCGTCCACAGGTAGGACGTACCCGTCGAGAAGGAATACCA
CCCAGGAATGTGGCTAATGTGCGGCAGAGTCTTTTTGGATTGGTCGGCCTTCAGACAGGAACAGAACTCATCTCG
CTAGCCCTAGTCCTCAACAAAGTGACGGGAGTTTACGGCCTGTTGGCGATATTGACAGGCTACCAACTGTCACTG
CTGCAATTGTCCACATATGTCTACTCGATTGCGGTGCTTGGAGTTCTCATCTACTTGATCCCACACATTCGCCGA
CAGAGTCCGTTTGAATGTCTGGCATTGGCATGGATCTATCTAGTGGACACCGTCGTCAACGGTGCCTGCACGGCT
GTTCTTGGGCTCGAGTGGTATTTTGCCAGCACTGCGGCTGAATTGGCTGAGTCGGGGCCGCCGCCATCTCTGCCG
AGCATCGTGACCGAGGGCCTAGAGGGGCTGCGCCGAGAAGGCGAGGTGCACGGCAAAGTAGTGCCACAAGAGACG
ATAACAAGCATGTTGTTGGTTGTGGGCTTGACCCTGATTCGCGTCTATTTTAGCGTCGTCGTCATGGCTTTTGCG
CGCCAGGTTTTGCGGAGACACATGCAGCTGCGGATCGTTGAAGGGCCCGAGGTGGATGCCGATGGAGATGAAGGT
CCGTTTGCTGCGCACCAACCCAATGGGAGTGGCCGTAGGGGACGTCTAGGCAGATTCATGGTGTCGATAGGCCGT
GGATACTGGCTCGACGGCAGCGAAATGGATGGGAACTGGCATAGGGCGCCAAACGGAAAGGGCCATGTGGAAGGC
ACCCTGGCAGGAGAAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail