Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5501
Gene name
LocationContig_43:18716..20078
Strand-
Gene length (bp)1362
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07767 Nop53 Nop53 (60S ribosomal biogenesis) 7.4E-111 22 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUI4|YIY9_SCHPO Uncharacterized protein C22F8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.09 PE=1 SV=1 13 434 4.0E-42
sp|Q12080|NOP53_YEAST Ribosome biogenesis protein NOP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP53 PE=1 SV=1 12 434 2.0E-26
sp|Q9NZM5|GSCR2_HUMAN Glioma tumor suppressor candidate region gene 2 protein OS=Homo sapiens GN=GLTSCR2 PE=1 SV=2 37 434 4.0E-16
sp|Q9NEU5|GSCR2_CAEEL Uncharacterized protein Y39B6A.33 OS=Caenorhabditis elegans GN=Y39B6A.33 PE=3 SV=1 22 435 5.0E-11
sp|Q9W3C2|GSCR2_DROME Uncharacterized protein CG1785 OS=Drosophila melanogaster GN=CG1785 PE=2 SV=1 28 419 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUI4|YIY9_SCHPO Uncharacterized protein C22F8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.09 PE=1 SV=1 13 434 4.0E-42
sp|Q12080|NOP53_YEAST Ribosome biogenesis protein NOP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP53 PE=1 SV=1 12 434 2.0E-26
sp|Q9NZM5|GSCR2_HUMAN Glioma tumor suppressor candidate region gene 2 protein OS=Homo sapiens GN=GLTSCR2 PE=1 SV=2 37 434 4.0E-16
sp|Q9NEU5|GSCR2_CAEEL Uncharacterized protein Y39B6A.33 OS=Caenorhabditis elegans GN=Y39B6A.33 PE=3 SV=1 22 435 5.0E-11
sp|Q9W3C2|GSCR2_DROME Uncharacterized protein CG1785 OS=Drosophila melanogaster GN=CG1785 PE=2 SV=1 28 419 1.0E-08
sp|O22892|GSR2_ARATH Uncharacterized protein At2g40430 OS=Arabidopsis thaliana GN=At2g40430 PE=1 SV=2 22 239 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5501
MPLIQSLSGRPTDSPKQHNQPSRKGKKAWRKHVDVTEVEQGLQQLNEEIIRGGVIKEKPSSELFTIDLDGDSKIP
QRFSKHIKKGLKADEIISQRSAVPAVSQRKRAADKTTNGLVTAKRLRTDWVSHKELSRLRKITHGHHESTVAIKD
ATFDLWDTTREPSSENPSEYLPNKCVAKVPKSMKQQPISLTASGKHVRAVQTPSGGYSYNPNFVDYEQRLIEECS
KAVELEKKRLAKEEAERLKMEAAARSAAEAEAAEERANLSEWEEDSEWEGFQSGAEDSLRANQPKRKTQAQRNRI
KRRKEEERIMTQKAALKIRRAQEQRIAELAQEVEEREQSKALVSAKQDDTEEEVTDDKLRRKQLGKFKLPEKDVE
LVLPDELQESLRLLKPEGNLLKDRYRSMLVRGKLESRRRIPFKRQAQKKLTEKWSYKDFVI*
Coding >OphauB2|5501
ATGCCTCTTATTCAAAGCCTGTCGGGTCGACCCACAGATTCTCCAAAACAACATAATCAACCTTCTAGGAAAGGC
AAGAAGGCCTGGAGAAAGCATGTTGATGTTACGGAGGTTGAACAAGGCTTGCAGCAGCTCAATGAAGAAATTATT
CGAGGCGGTGTTATCAAAGAGAAGCCCTCATCTGAGCTATTTACCATTGACCTCGATGGCGACTCCAAGATTCCT
CAAAGATTTTCCAAACACATAAAGAAGGGGCTCAAGGCCGATGAAATTATTTCCCAGCGTTCTGCCGTACCGGCC
GTTTCTCAGCGCAAGCGAGCAGCCGACAAGACGACAAACGGGCTTGTTACAGCAAAGCGCCTGCGGACCGATTGG
GTATCACACAAGGAGCTATCGCGACTGCGCAAGATTACACATGGGCACCATGAATCTACTGTGGCTATTAAGGAC
GCAACTTTTGATCTTTGGGATACAACAAGAGAACCAAGCAGCGAGAACCCCAGCGAATATTTGCCCAACAAATGC
GTAGCAAAGGTGCCCAAGTCGATGAAACAGCAGCCAATATCGTTGACGGCGAGCGGAAAGCACGTTCGTGCCGTG
CAGACTCCTTCTGGAGGCTATAGCTACAATCCCAACTTCGTCGACTACGAGCAACGGTTAATAGAGGAATGCTCC
AAGGCAGTCGAGCTAGAAAAGAAGCGTCTGGCCAAGGAGGAGGCTGAAAGATTAAAAATGGAGGCTGCTGCACGA
TCTGCCGCCGAGGCTGAGGCTGCTGAAGAGCGTGCAAATTTGTCGGAATGGGAAGAGGATTCGGAGTGGGAAGGA
TTCCAGAGTGGCGCGGAGGATAGTTTAAGGGCCAATCAACCCAAACGCAAGACCCAGGCCCAGCGAAACCGCATC
AAGCGCCGAAAAGAAGAGGAACGCATAATGACGCAGAAGGCTGCCCTGAAGATAAGACGGGCACAGGAGCAGCGA
ATAGCAGAACTCGCACAAGAGGTTGAGGAACGTGAGCAGAGCAAGGCGCTCGTATCAGCCAAACAAGACGACACA
GAAGAAGAGGTAACTGATGACAAGCTGCGGAGGAAACAACTTGGCAAATTCAAGCTCCCAGAAAAAGATGTCGAG
CTTGTGTTGCCGGATGAGCTGCAGGAATCCCTTCGACTTCTGAAACCAGAGGGTAACCTACTCAAAGATCGATAC
AGGAGCATGCTTGTTCGAGGCAAACTTGAGAGCCGAAGACGCATCCCATTCAAGCGTCAGGCACAGAAAAAGCTC
ACTGAAAAATGGAGCTACAAAGACTTTGTCATATAG
Transcript >OphauB2|5501
ATGCCTCTTATTCAAAGCCTGTCGGGTCGACCCACAGATTCTCCAAAACAACATAATCAACCTTCTAGGAAAGGC
AAGAAGGCCTGGAGAAAGCATGTTGATGTTACGGAGGTTGAACAAGGCTTGCAGCAGCTCAATGAAGAAATTATT
CGAGGCGGTGTTATCAAAGAGAAGCCCTCATCTGAGCTATTTACCATTGACCTCGATGGCGACTCCAAGATTCCT
CAAAGATTTTCCAAACACATAAAGAAGGGGCTCAAGGCCGATGAAATTATTTCCCAGCGTTCTGCCGTACCGGCC
GTTTCTCAGCGCAAGCGAGCAGCCGACAAGACGACAAACGGGCTTGTTACAGCAAAGCGCCTGCGGACCGATTGG
GTATCACACAAGGAGCTATCGCGACTGCGCAAGATTACACATGGGCACCATGAATCTACTGTGGCTATTAAGGAC
GCAACTTTTGATCTTTGGGATACAACAAGAGAACCAAGCAGCGAGAACCCCAGCGAATATTTGCCCAACAAATGC
GTAGCAAAGGTGCCCAAGTCGATGAAACAGCAGCCAATATCGTTGACGGCGAGCGGAAAGCACGTTCGTGCCGTG
CAGACTCCTTCTGGAGGCTATAGCTACAATCCCAACTTCGTCGACTACGAGCAACGGTTAATAGAGGAATGCTCC
AAGGCAGTCGAGCTAGAAAAGAAGCGTCTGGCCAAGGAGGAGGCTGAAAGATTAAAAATGGAGGCTGCTGCACGA
TCTGCCGCCGAGGCTGAGGCTGCTGAAGAGCGTGCAAATTTGTCGGAATGGGAAGAGGATTCGGAGTGGGAAGGA
TTCCAGAGTGGCGCGGAGGATAGTTTAAGGGCCAATCAACCCAAACGCAAGACCCAGGCCCAGCGAAACCGCATC
AAGCGCCGAAAAGAAGAGGAACGCATAATGACGCAGAAGGCTGCCCTGAAGATAAGACGGGCACAGGAGCAGCGA
ATAGCAGAACTCGCACAAGAGGTTGAGGAACGTGAGCAGAGCAAGGCGCTCGTATCAGCCAAACAAGACGACACA
GAAGAAGAGGTAACTGATGACAAGCTGCGGAGGAAACAACTTGGCAAATTCAAGCTCCCAGAAAAAGATGTCGAG
CTTGTGTTGCCGGATGAGCTGCAGGAATCCCTTCGACTTCTGAAACCAGAGGGTAACCTACTCAAAGATCGATAC
AGGAGCATGCTTGTTCGAGGCAAACTTGAGAGCCGAAGACGCATCCCATTCAAGCGTCAGGCACAGAAAAAGCTC
ACTGAAAAATGGAGCTACAAAGACTTTGTCATATAG
Gene >OphauB2|5501
ATGCCTCTTATTCAAAGCCTGTCGGGTCGACCCACAGATTCTCCAAAACAACATAATCAACCTTCTAGGAAAGGC
AAGAAGGCCTGGAGAAAGCATGTTGATGTTACGGAGGTTGAACAAGGCTTGCAGCAGCTCAATGAAGAAATTATT
CGAGGGTAAGGCATCTCTCATAGTCAGCAGTATACTTGACACTAAAGGCTACAAAGCGGTGTTATCAAAGAGAAG
CCCTCATCTGAGCTATTTACCATTGACCTCGATGGCGACTCCAAGATTCCTCAAAGATTTTCCAAACACATAAAG
AAGGGGCTCAAGGCCGATGAAATTATTTCCCAGCGTTCTGCCGTACCGGCCGTTTCTCAGCGCAAGCGAGCAGCC
GACAAGACGACAAACGGGCTTGTTACAGCAAAGCGCCTGCGGACCGATTGGGTATCACACAAGGAGCTATCGCGA
CTGCGCAAGATTACACATGGGCACCATGAATCTACTGTGGCTATTAAGGACGCAACTTTTGATCTTTGGGATACA
ACAAGAGAACCAAGCAGCGAGAACCCCAGCGAATATTTGCCCAACAAATGCGTAGCAAAGGTGCCCAAGTCGATG
AAACAGCAGCCAATATCGTTGACGGCGAGCGGAAAGCACGTTCGTGCCGTGCAGACTCCTTCTGGAGGCTATAGC
TACAATCCCAACTTCGTCGACTACGAGCAACGGTTAATAGAGGAATGCTCCAAGGCAGTCGAGCTAGAAAAGAAG
CGTCTGGCCAAGGAGGAGGCTGAAAGATTAAAAATGGAGGCTGCTGCACGATCTGCCGCCGAGGCTGAGGCTGCT
GAAGAGCGTGCAAATTTGTCGGAATGGGAAGAGGATTCGGAGTGGGAAGGATTCCAGAGTGGCGCGGAGGATAGT
TTAAGGGCCAATCAACCCAAACGCAAGACCCAGGCCCAGCGAAACCGCATCAAGCGCCGAAAAGAAGAGGAACGC
ATAATGACGCAGAAGGCTGCCCTGAAGATAAGACGGGCACAGGAGCAGCGAATAGCAGAACTCGCACAAGAGGTT
GAGGAACGTGAGCAGAGCAAGGCGCTCGTATCAGCCAAACAAGACGACACAGAAGAAGAGGTAACTGATGACAAG
CTGCGGAGGAAACAACTTGGCAAATTCAAGCTCCCAGAAAAAGATGTCGAGCTTGTGTTGCCGGATGAGCTGCAG
GAATCCCTTCGACTTCTGAAACCAGAGGGTAACCTACTCAAAGATCGATACAGGAGCATGCTTGTTCGAGGCAAA
CTTGAGAGCCGAAGACGCATCCCATTCAAGCGTCAGGCACAGAAAAAGCTCACTGAAAAATGGAGCTACAAAGAC
TTTGTCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail