Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5493
Gene name
LocationContig_429:1805..2639
Strand-
Gene length (bp)834
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 2.3E-17 12 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14348|NC2B_SCHPO Negative cofactor 2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncb2 PE=3 SV=1 6 135 2.0E-51
sp|Q5XI68|NC2B_RAT Protein Dr1 OS=Rattus norvegicus GN=Dr1 PE=2 SV=1 1 133 8.0E-32
sp|Q5ZMV3|NC2B_CHICK Protein Dr1 OS=Gallus gallus GN=DR1 PE=2 SV=1 1 133 8.0E-32
sp|Q01658|NC2B_HUMAN Protein Dr1 OS=Homo sapiens GN=DR1 PE=1 SV=1 1 133 8.0E-32
sp|Q91WV0|NC2B_MOUSE Protein Dr1 OS=Mus musculus GN=Dr1 PE=1 SV=1 1 133 8.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14348|NC2B_SCHPO Negative cofactor 2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncb2 PE=3 SV=1 6 135 2.0E-51
sp|Q5XI68|NC2B_RAT Protein Dr1 OS=Rattus norvegicus GN=Dr1 PE=2 SV=1 1 133 8.0E-32
sp|Q5ZMV3|NC2B_CHICK Protein Dr1 OS=Gallus gallus GN=DR1 PE=2 SV=1 1 133 8.0E-32
sp|Q01658|NC2B_HUMAN Protein Dr1 OS=Homo sapiens GN=DR1 PE=1 SV=1 1 133 8.0E-32
sp|Q91WV0|NC2B_MOUSE Protein Dr1 OS=Mus musculus GN=Dr1 PE=1 SV=1 1 133 8.0E-32
sp|Q55DJ5|NC2B_DICDI Protein Dr1 homolog OS=Dictyostelium discoideum GN=dr1 PE=3 SV=1 1 133 2.0E-31
sp|P49592|NC2B_ARATH Protein Dr1 homolog OS=Arabidopsis thaliana GN=DR1 PE=2 SV=1 9 135 2.0E-30
sp|Q92317|NCB2_YEAST Negative cofactor 2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCB2 PE=1 SV=1 8 135 2.0E-27
sp|Q9VJQ5|NC2B_DROME Protein Dr1 OS=Drosophila melanogaster GN=NC2beta PE=1 SV=1 8 131 8.0E-27
sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2 10 121 1.0E-14
sp|O04027|NFYB4_ARATH Nuclear transcription factor Y subunit B-4 OS=Arabidopsis thaliana GN=NFYB4 PE=1 SV=1 8 123 6.0E-12
sp|P25207|NFYB_CHICK Nuclear transcription factor Y subunit beta OS=Gallus gallus GN=NFYB PE=2 SV=2 1 130 1.0E-11
sp|Q6RG77|NFYB_HORSE Nuclear transcription factor Y subunit beta OS=Equus caballus GN=NFYB PE=2 SV=1 1 130 3.0E-11
sp|P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens GN=NFYB PE=1 SV=2 1 130 3.0E-11
sp|P63140|NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus GN=Nfyb PE=1 SV=1 1 130 4.0E-11
sp|P63139|NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus GN=Nfyb PE=1 SV=1 1 130 4.0E-11
sp|O82248|NFYB5_ARATH Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1 10 86 5.0E-11
sp|Q32KW0|NFYB_BOVIN Nuclear transcription factor Y subunit beta OS=Bos taurus GN=NFYB PE=2 SV=1 1 103 6.0E-11
sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 10 101 8.0E-11
sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana GN=NFYB8 PE=2 SV=1 4 112 8.0E-11
sp|P25210|NFYB_PETMA Nuclear transcription factor Y subunit beta OS=Petromyzon marinus GN=NFYB PE=2 SV=1 6 103 2.0E-10
sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1 10 87 2.0E-10
sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1 10 87 3.0E-10
sp|Q9SIT9|NFYB7_ARATH Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana GN=NFYB7 PE=2 SV=1 10 87 3.0E-10
sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana GN=NFYB10 PE=2 SV=1 10 137 3.0E-10
sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2 10 87 3.0E-10
sp|Q84W66|NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana GN=NFYB6 PE=1 SV=2 10 104 1.0E-09
sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana GN=NFYB9 PE=1 SV=2 10 104 1.0E-09
sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens GN=POLE3 PE=1 SV=1 9 110 3.0E-09
sp|Q5QMG3|NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica GN=NFYB2 PE=2 SV=1 10 100 3.0E-09
sp|Q3SZN5|DPOE3_BOVIN DNA polymerase epsilon subunit 3 OS=Bos taurus GN=POLE3 PE=2 SV=1 9 110 3.0E-09
sp|Q5R4W3|DPOE3_PONAB DNA polymerase epsilon subunit 3 OS=Pongo abelii GN=POLE3 PE=2 SV=1 9 110 3.0E-09
sp|Q642A5|DPOE3_RAT DNA polymerase epsilon subunit 3 OS=Rattus norvegicus GN=Pole3 PE=1 SV=1 9 110 4.0E-09
sp|P36611|HAP3_SCHPO Transcriptional activator hap3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap3 PE=3 SV=1 13 101 5.0E-09
sp|Q54WV0|NFYB_DICDI Nuclear transcription factor Y subunit beta OS=Dictyostelium discoideum GN=nfyB PE=3 SV=1 10 107 1.0E-08
sp|Q65XK1|NFYB4_ORYSJ Nuclear transcription factor Y subunit B-4 OS=Oryza sativa subsp. japonica GN=NFYB4 PE=2 SV=2 10 87 2.0E-08
sp|Q9JKP7|DPOE3_MOUSE DNA polymerase epsilon subunit 3 OS=Mus musculus GN=Pole3 PE=1 SV=1 9 110 2.0E-08
sp|P13434|HAP3_YEAST Transcriptional activator HAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP3 PE=1 SV=1 10 101 7.0E-07
sp|P25211|NFYB_XENLA Nuclear transcription factor Y subunit beta (Fragment) OS=Xenopus laevis GN=nfyb PE=2 SV=1 44 130 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5493
MSDHEYGNDDLSLPKATVQKIVGEILPPQRGMAFAKEARDLLIECCVEFITLISSEANEISEKEAKKTIACDHIT
KALEQLGFSDYVPAVLEAAAEHKEVQKGREKKADKFANSGMSMEELARLQEEQFAQARQRHT*
Coding >OphauB2|5493
ATGTCGGACCACGAATATGGAAACGATGATCTCTCCCTCCCCAAAGCCACCGTGCAGAAAATTGTGGGCGAAATC
CTGCCGCCCCAGCGCGGCATGGCATTTGCCAAGGAGGCTCGCGACTTGCTCATTGAATGCTGCGTCGAATTCATC
ACACTCATCTCATCAGAAGCCAACGAAATTTCGGAAAAGGAGGCCAAGAAGACGATAGCCTGCGATCACATCACC
AAAGCACTCGAACAGCTTGGCTTCTCCGACTACGTACCAGCCGTCCTCGAGGCGGCCGCCGAGCATAAAGAGGTT
CAAAAGGGCCGCGAGAAAAAAGCCGACAAGTTTGCCAATAGTGGTATGTCCATGGAGGAACTCGCTCGGTTGCAA
GAGGAACAGTTTGCCCAGGCGCGACAACGACACACATGA
Transcript >OphauB2|5493
ATGTCGGACCACGAATATGGAAACGATGATCTCTCCCTCCCCAAAGCCACCGTGCAGAAAATTGTGGGCGAAATC
CTGCCGCCCCAGCGCGGCATGGCATTTGCCAAGGAGGCTCGCGACTTGCTCATTGAATGCTGCGTCGAATTCATC
ACACTCATCTCATCAGAAGCCAACGAAATTTCGGAAAAGGAGGCCAAGAAGACGATAGCCTGCGATCACATCACC
AAAGCACTCGAACAGCTTGGCTTCTCCGACTACGTACCAGCCGTCCTCGAGGCGGCCGCCGAGCATAAAGAGGTT
CAAAAGGGCCGCGAGAAAAAAGCCGACAAGTTTGCCAATAGTGGTATGTCCATGGAGGAACTCGCTCGGTTGCAA
GAGGAACAGTTTGCCCAGGCGCGACAACGACACACATGA
Gene >OphauB2|5493
ATGTCGGACCACGAATATGGTGAGTCGCCAAGCAGCACCTCCAAAAGTTGGACGCATGTGTGGCCATTTCCAAAG
TATTGGTGGCCGCGTACACGTGTCTCTGGCGAGATTTATGCTCTTGGCCTTGGGGCAGTCTCGACGACGCGGGTA
TTTTTGCTTGCAGCCCATGTGCGACTTGTCGCGCAATCTCCGTTATGGGATCTCTGTGCTTCTTCCCAGCGATGC
CAAGTGAAGCAGGCTGCTTAGTCTCGCTACGGCTTGGGCCTGTCATGGGATTCTAATCCGTGGACTTTACCGAGG
ACCGTTACTGACGAGTCGCCGCTTCAGGAAACGATGATCTCTCCCTCCCCAAAGGTGAGTGTGTCCTAGGCGTCG
CATCTACGATGCAAGCGTAGCTGACCGGCTCAGCCACCGTGCAGAAAATTGTGGGCGAAATCCTGCCGCCCCAGC
GCGGCATGGCATTTGCCAAGGAGGCTCGCGACTTGCTCATTGAATGCTGCGTCGAATTCATCACACTCATCTCAT
CAGAAGCCAACGAAATTTCGGAAAAGGAGGCCAAGAAGACGATAGCCTGCGATCACATCACCAAAGCACTCGAAC
AGCTTGGCTTCTCCGACTACGTACCAGCCGTCCTCGAGGCGGCCGCCGAGCATAAAGAGGTTCAAAAGGTTGGTC
GTGTGTGCGCATGCCCTGTTTCGCCCTGGGCTCGTTGACTAACTGGCGCAGGGCCGCGAGAAAAAAGCCGACAAG
TTTGCCAATAGTGGTATGTCCATGGAGGAACTCGCTCGGTTGCAAGAGGAACAGTTTGCCCAGGCGCGACAACGA
CACACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail