Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|549
Gene name
LocationContig_11:58729..60430
Strand+
Gene length (bp)1701
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 6.1E-07 77 382

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 21 563 6.0E-153
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 29 566 8.0E-137
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 29 559 2.0E-118
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 17 562 5.0E-117
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 17 562 7.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 21 563 6.0E-153
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 29 566 8.0E-137
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 29 559 2.0E-118
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 17 562 5.0E-117
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 17 562 7.0E-117
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 2 547 8.0E-91
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 5 555 4.0E-79
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 5 565 1.0E-72
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 22 538 8.0E-72
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 5 539 6.0E-60
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 5 514 1.0E-53
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 5 542 2.0E-45
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 30 554 5.0E-09
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 24 565 2.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 24 565 5.0E-08
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 78 340 2.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 12 301 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 83 105 22
3 110 132 22
4 145 167 22
5 177 199 22
6 229 251 22
7 266 288 22
8 301 320 19
9 340 362 22
10 369 391 22
11 401 423 22
12 436 458 22
13 510 532 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|549
MTSLGVARVAALSKVLTLTDRICIFAGVFLVAYVYGLDGTLRYAYQPLATASFNSHSLQATVNVIRGVVAAAAQP
TAAKVADVFGRVELICLSALFYIVGTIIEATAHNISTFIGGNVIYQIGYTSIIFLVEIIIADITSTRTRLFFSYI
PALPFIINTWVSGNVASSVLASTSWRWGIGMWGIIFPVCALPLVLSLTLASRRARHNGLAPSFHSVLHGRKPLEF
AMELFWLLDVVGLLLIIAALVMILVPLTIAGGFSSKWHSAGIIAPLVLGLCCLPAFVLWELCAPHPLAPFSFMKQ
RAVWAPFGIALTLFFAYAIQSDYLFTVLQVAFDFSTTTATRITSLYSFCSVIVGTLLGLLVIHLRRLKVFVVAGT
ALYMVAFGLLIHFRGANMGSPGRSGIIGAQVLLGIAGGLFPYATQAILQVGLLHEHMAVMTGIFLATYNIGSALG
NTVSGAIWTQLLPSRLEQRLAGVNASLAGPAYENPFTSVVAAYPMGTPERTAVIDAYQSVQRILCIAGVVVCVPL
ICFALLLPNPRLNNDQSLATKKSVTSLHQSTVADEENNSGV*
Coding >OphauB2|549
ATGACGTCGCTGGGCGTGGCGCGCGTGGCTGCTCTTTCCAAAGTCTTGACGCTGACGGATCGCATCTGCATCTTT
GCTGGTGTTTTCCTCGTGGCCTATGTGTACGGGCTCGACGGCACGCTGCGGTATGCATACCAGCCGCTGGCGACG
GCGTCGTTTAATAGCCATTCGCTACAGGCAACAGTCAATGTGATTCGAGGCGTCGTGGCGGCGGCGGCGCAGCCC
ACGGCGGCAAAGGTGGCGGATGTGTTTGGGCGCGTTGAGCTGATTTGTCTGTCGGCGCTGTTTTATATCGTCGGT
ACTATTATCGAGGCAACGGCACATAATATTAGCACCTTTATCGGCGGCAATGTCATTTACCAAATCGGATACACG
AGCATCATCTTTCTCGTCGAAATCATCATTGCAGACATCACCTCGACGCGCACCCGTCTCTTCTTTAGCTATATT
CCCGCCCTGCCCTTTATAATCAATACGTGGGTGAGCGGCAACGTTGCCAGCTCCGTCCTCGCCTCCACCTCGTGG
CGCTGGGGCATCGGCATGTGGGGCATCATCTTCCCCGTCTGCGCCCTGCCTCTGGTGCTCAGTCTGACGCTGGCT
TCACGGCGCGCCAGGCATAACGGCTTGGCTCCCAGCTTTCACTCTGTCCTGCACGGCCGCAAGCCCCTCGAGTTT
GCCATGGAGCTGTTTTGGCTGCTCGACGTTGTTGGCCTCCTCCTCATCATTGCCGCCCTCGTCATGATTCTCGTG
CCGCTCACCATTGCCGGCGGCTTCTCCTCAAAGTGGCACTCGGCCGGCATCATCGCCCCCCTCGTCCTTGGCCTT
TGCTGCCTGCCGGCTTTTGTCCTCTGGGAACTGTGCGCGCCGCATCCCCTTGCGCCCTTTTCCTTTATGAAGCAG
CGCGCCGTCTGGGCGCCCTTTGGCATCGCCCTGACCCTCTTCTTTGCCTATGCCATCCAGTCCGACTACCTCTTT
ACCGTCCTCCAGGTGGCCTTTGACTTTTCCACTACCACGGCCACGCGCATCACCTCGCTCTACTCCTTTTGCAGC
GTCATTGTTGGCACGCTGCTCGGCCTCCTCGTCATCCACCTCCGTCGCCTCAAGGTCTTTGTCGTGGCAGGCACC
GCCCTCTACATGGTGGCCTTTGGCCTCTTGATTCACTTTCGCGGCGCAAACATGGGCTCGCCTGGCCGCTCCGGC
ATCATTGGCGCTCAGGTCCTGCTCGGCATTGCTGGCGGCCTCTTTCCCTATGCCACTCAGGCCATTCTCCAGGTC
GGCCTGCTGCACGAGCACATGGCCGTCATGACGGGCATCTTTCTCGCCACTTACAACATTGGCTCTGCCCTCGGC
AATACCGTCTCGGGCGCCATTTGGACCCAGCTGCTGCCCTCGCGCCTTGAGCAGCGTCTGGCTGGCGTCAATGCC
TCTTTGGCTGGCCCCGCCTATGAGAATCCATTTACCAGCGTCGTTGCCGCCTATCCCATGGGAACGCCCGAGCGA
ACCGCCGTCATTGACGCCTACCAGTCGGTGCAGCGCATCCTCTGCATTGCCGGAGTCGTTGTCTGCGTGCCGCTC
ATTTGCTTTGCGCTGCTGCTGCCGAATCCGCGCTTGAATAATGATCAGTCCTTGGCAACCAAGAAGAGTGTGACT
TCGCTCCATCAGAGCACGGTTGCTGACGAGGAGAATAACAGTGGCGTTTAA
Transcript >OphauB2|549
ATGACGTCGCTGGGCGTGGCGCGCGTGGCTGCTCTTTCCAAAGTCTTGACGCTGACGGATCGCATCTGCATCTTT
GCTGGTGTTTTCCTCGTGGCCTATGTGTACGGGCTCGACGGCACGCTGCGGTATGCATACCAGCCGCTGGCGACG
GCGTCGTTTAATAGCCATTCGCTACAGGCAACAGTCAATGTGATTCGAGGCGTCGTGGCGGCGGCGGCGCAGCCC
ACGGCGGCAAAGGTGGCGGATGTGTTTGGGCGCGTTGAGCTGATTTGTCTGTCGGCGCTGTTTTATATCGTCGGT
ACTATTATCGAGGCAACGGCACATAATATTAGCACCTTTATCGGCGGCAATGTCATTTACCAAATCGGATACACG
AGCATCATCTTTCTCGTCGAAATCATCATTGCAGACATCACCTCGACGCGCACCCGTCTCTTCTTTAGCTATATT
CCCGCCCTGCCCTTTATAATCAATACGTGGGTGAGCGGCAACGTTGCCAGCTCCGTCCTCGCCTCCACCTCGTGG
CGCTGGGGCATCGGCATGTGGGGCATCATCTTCCCCGTCTGCGCCCTGCCTCTGGTGCTCAGTCTGACGCTGGCT
TCACGGCGCGCCAGGCATAACGGCTTGGCTCCCAGCTTTCACTCTGTCCTGCACGGCCGCAAGCCCCTCGAGTTT
GCCATGGAGCTGTTTTGGCTGCTCGACGTTGTTGGCCTCCTCCTCATCATTGCCGCCCTCGTCATGATTCTCGTG
CCGCTCACCATTGCCGGCGGCTTCTCCTCAAAGTGGCACTCGGCCGGCATCATCGCCCCCCTCGTCCTTGGCCTT
TGCTGCCTGCCGGCTTTTGTCCTCTGGGAACTGTGCGCGCCGCATCCCCTTGCGCCCTTTTCCTTTATGAAGCAG
CGCGCCGTCTGGGCGCCCTTTGGCATCGCCCTGACCCTCTTCTTTGCCTATGCCATCCAGTCCGACTACCTCTTT
ACCGTCCTCCAGGTGGCCTTTGACTTTTCCACTACCACGGCCACGCGCATCACCTCGCTCTACTCCTTTTGCAGC
GTCATTGTTGGCACGCTGCTCGGCCTCCTCGTCATCCACCTCCGTCGCCTCAAGGTCTTTGTCGTGGCAGGCACC
GCCCTCTACATGGTGGCCTTTGGCCTCTTGATTCACTTTCGCGGCGCAAACATGGGCTCGCCTGGCCGCTCCGGC
ATCATTGGCGCTCAGGTCCTGCTCGGCATTGCTGGCGGCCTCTTTCCCTATGCCACTCAGGCCATTCTCCAGGTC
GGCCTGCTGCACGAGCACATGGCCGTCATGACGGGCATCTTTCTCGCCACTTACAACATTGGCTCTGCCCTCGGC
AATACCGTCTCGGGCGCCATTTGGACCCAGCTGCTGCCCTCGCGCCTTGAGCAGCGTCTGGCTGGCGTCAATGCC
TCTTTGGCTGGCCCCGCCTATGAGAATCCATTTACCAGCGTCGTTGCCGCCTATCCCATGGGAACGCCCGAGCGA
ACCGCCGTCATTGACGCCTACCAGTCGGTGCAGCGCATCCTCTGCATTGCCGGAGTCGTTGTCTGCGTGCCGCTC
ATTTGCTTTGCGCTGCTGCTGCCGAATCCGCGCTTGAATAATGATCAGTCCTTGGCAACCAAGAAGAGTGTGACT
TCGCTCCATCAGAGCACGGTTGCTGACGAGGAGAATAACAGTGGCGTTTAA
Gene >OphauB2|549
ATGACGTCGCTGGGCGTGGCGCGCGTGGCTGCTCTTTCCAAAGTCTTGACGCTGACGGATCGCATCTGCATCTTT
GCTGGTGTTTTCCTCGTGGCCTATGTGTACGGGCTCGACGGCACGCTGCGGTATGCATACCAGCCGCTGGCGACG
GCGTCGTTTAATAGCCATTCGCTACAGGCAACAGTCAATGTGATTCGAGGCGTCGTGGCGGCGGCGGCGCAGCCC
ACGGCGGCAAAGGTGGCGGATGTGTTTGGGCGCGTTGAGCTGATTTGTCTGTCGGCGCTGTTTTATATCGTCGGT
ACTATTATCGAGGCAACGGCACATAATATTAGCACCTTTATCGGCGGCAATGTCATTTACCAAATCGGATACACG
AGCATCATCTTTCTCGTCGAAATCATCATTGCAGACATCACCTCGACGCGCACCCGTCTCTTCTTTAGCTATATT
CCCGCCCTGCCCTTTATAATCAATACGTGGGTGAGCGGCAACGTTGCCAGCTCCGTCCTCGCCTCCACCTCGTGG
CGCTGGGGCATCGGCATGTGGGGCATCATCTTCCCCGTCTGCGCCCTGCCTCTGGTGCTCAGTCTGACGCTGGCT
TCACGGCGCGCCAGGCATAACGGCTTGGCTCCCAGCTTTCACTCTGTCCTGCACGGCCGCAAGCCCCTCGAGTTT
GCCATGGAGCTGTTTTGGCTGCTCGACGTTGTTGGCCTCCTCCTCATCATTGCCGCCCTCGTCATGATTCTCGTG
CCGCTCACCATTGCCGGCGGCTTCTCCTCAAAGTGGCACTCGGCCGGCATCATCGCCCCCCTCGTCCTTGGCCTT
TGCTGCCTGCCGGCTTTTGTCCTCTGGGAACTGTGCGCGCCGCATCCCCTTGCGCCCTTTTCCTTTATGAAGCAG
CGCGCCGTCTGGGCGCCCTTTGGCATCGCCCTGACCCTCTTCTTTGCCTATGCCATCCAGTCCGACTACCTCTTT
ACCGTCCTCCAGGTGGCCTTTGACTTTTCCACTACCACGGCCACGCGCATCACCTCGCTCTACTCCTTTTGCAGC
GTCATTGTTGGCACGCTGCTCGGCCTCCTCGTCATCCACCTCCGTCGCCTCAAGGTCTTTGTCGTGGCAGGCACC
GCCCTCTACATGGTGGCCTTTGGCCTCTTGATTCACTTTCGCGGCGCAAACATGGGCTCGCCTGGCCGCTCCGGC
ATCATTGGCGCTCAGGTCCTGCTCGGCATTGCTGGCGGCCTCTTTCCCTATGCCACTCAGGCCATTCTCCAGGTC
GGCCTGCTGCACGAGCACATGGCCGTCATGACGGGCATCTTTCTCGCCACTTACAACATTGGCTCTGCCCTCGGC
AATACCGTCTCGGGCGCCATTTGGACCCAGCTGCTGCCCTCGCGCCTTGAGCAGCGTCTGGCTGGCGTCAATGCC
TCTTTGGCTGGCCCCGCCTATGAGAATCCATTTACCAGCGTCGTTGCCGCCTATCCCATGGGAACGCCCGAGCGA
ACCGCCGTCATTGACGCCTACCAGTCGGTGCAGCGCATCCTCTGCATTGCCGGAGTCGTTGTCTGCGTGCCGCTC
ATTTGCTTTGCGCTGCTGCTGCCGAATCCGCGCTTGAATAATGATCAGTCCTTGGCAACCAAGAAGAGTGTGACT
TCGCTCCATCAGAGCACGGTTGCTGACGAGGAGAATAACAGTGGCGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail