Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5482
Gene name
LocationContig_42:134040..135094
Strand+
Gene length (bp)1054
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.5E-10 223 288
PF09011 HMG_box_2 HMG-box domain 7.0E-07 224 289

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 158 291 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5482
MLVSIGRVAARRVLAPAPFKLLVAAALHRRIVDLGARGIAVSALAQSPAAKGTVSSSIKAKSSAKAKAKSKAKSK
ATKSKATKKPKAPKPKATKTTASPKRLTPEQKQKHAILFLQRLALVKEMPKNPPKSAWNVFISRKITKASPLASS
MAGLSSAFASLPDDAKRDLNNEAARNRHAHVEKLKAWVQEYPPEAIYVANLARRRLSRKLSKRFAKISDHRLPAR
PISSFFHYYIKRRGDGIIDSDHAGFGNVSRQVGSEWKSLAPSEKKKYDAMYQEDAERFQREFSTLKPKIKEYIKA
QKQDFGRTTLAKSTKKTATGKVSI*
Coding >OphauB2|5482
ATGCTCGTCTCAATTGGCCGCGTCGCCGCACGCCGAGTGCTGGCCCCGGCGCCATTCAAGCTCCTCGTGGCCGCG
GCCTTGCATCGCCGCATCGTGGACCTGGGCGCCCGCGGCATTGCAGTCTCGGCCTTGGCACAGTCTCCAGCAGCA
AAGGGCACTGTCTCTTCGTCCATCAAGGCCAAATCCAGCGCCAAAGCAAAGGCCAAATCAAAGGCCAAATCAAAA
GCCACCAAGTCCAAGGCCACCAAGAAGCCCAAGGCTCCCAAGCCCAAGGCCACCAAGACGACGGCTTCACCCAAG
CGCCTGACGCCCGAACAGAAGCAGAAGCACGCTATCCTCTTCCTCCAACGCCTCGCCTTAGTAAAAGAGATGCCC
AAGAACCCGCCCAAGTCGGCTTGGAACGTTTTTATCTCGAGGAAGATAACCAAGGCATCCCCTCTGGCGTCCAGT
ATGGCCGGGCTATCGTCGGCGTTTGCTTCACTCCCAGACGACGCCAAGAGAGACCTTAACAATGAAGCCGCGCGC
AACAGACATGCCCATGTTGAAAAGCTAAAGGCTTGGGTTCAGGAGTACCCGCCAGAAGCTATTTACGTGGCCAAT
CTTGCCCGCCGCCGCCTGTCCCGCAAGTTGAGCAAGAGATTTGCTAAGATTTCAGACCACCGCCTCCCCGCGCGA
CCTATTAGCTCCTTTTTTCACTACTACATCAAGCGCCGTGGAGATGGTATTATCGACAGCGACCATGCCGGCTTT
GGCAATGTATCGCGCCAGGTGGGAAGCGAATGGAAATCCCTTGCCCCGAGTGAAAAGAAGAAATATGACGCCATG
TATCAGGAGGATGCAGAGCGCTTCCAGCGCGAATTCAGCACCCTCAAGCCCAAGATAAAGGAATACATCAAGGCA
CAAAAGCAAGACTTTGGAAGAACCACGCTCGCCAAATCCACCAAAAAAACTGCGACAGGGAAAGTCTCGATTTAG
Transcript >OphauB2|5482
ATGCTCGTCTCAATTGGCCGCGTCGCCGCACGCCGAGTGCTGGCCCCGGCGCCATTCAAGCTCCTCGTGGCCGCG
GCCTTGCATCGCCGCATCGTGGACCTGGGCGCCCGCGGCATTGCAGTCTCGGCCTTGGCACAGTCTCCAGCAGCA
AAGGGCACTGTCTCTTCGTCCATCAAGGCCAAATCCAGCGCCAAAGCAAAGGCCAAATCAAAGGCCAAATCAAAA
GCCACCAAGTCCAAGGCCACCAAGAAGCCCAAGGCTCCCAAGCCCAAGGCCACCAAGACGACGGCTTCACCCAAG
CGCCTGACGCCCGAACAGAAGCAGAAGCACGCTATCCTCTTCCTCCAACGCCTCGCCTTAGTAAAAGAGATGCCC
AAGAACCCGCCCAAGTCGGCTTGGAACGTTTTTATCTCGAGGAAGATAACCAAGGCATCCCCTCTGGCGTCCAGT
ATGGCCGGGCTATCGTCGGCGTTTGCTTCACTCCCAGACGACGCCAAGAGAGACCTTAACAATGAAGCCGCGCGC
AACAGACATGCCCATGTTGAAAAGCTAAAGGCTTGGGTTCAGGAGTACCCGCCAGAAGCTATTTACGTGGCCAAT
CTTGCCCGCCGCCGCCTGTCCCGCAAGTTGAGCAAGAGATTTGCTAAGATTTCAGACCACCGCCTCCCCGCGCGA
CCTATTAGCTCCTTTTTTCACTACTACATCAAGCGCCGTGGAGATGGTATTATCGACAGCGACCATGCCGGCTTT
GGCAATGTATCGCGCCAGGTGGGAAGCGAATGGAAATCCCTTGCCCCGAGTGAAAAGAAGAAATATGACGCCATG
TATCAGGAGGATGCAGAGCGCTTCCAGCGCGAATTCAGCACCCTCAAGCCCAAGATAAAGGAATACATCAAGGCA
CAAAAGCAAGACTTTGGAAGAACCACGCTCGCCAAATCCACCAAAAAAACTGCGACAGGGAAAGTCTCGATTTAG
Gene >OphauB2|5482
ATGCTCGTCTCAATTGGCCGCGTCGCCGCACGCCGAGTGCTGGCCCCGGCGCCATTCAAGCTCCTCGTGGCCGCG
GCCTTGCATCGCCGCATCGTGGACCTGGGCGCCCGCGGCATTGCAGTCTCGGCCTTGGCACAGTCTCCAGCAGCA
AAGGGCACTGTCTCTTCGTCCATCAAGGCCAAATCCAGCGCCAAAGCAAAGGCCAAATCAAAGGCCAAATCAAAA
GCCACCAAGTCCAAGGCCACCAAGAAGCCCAAGGCTCCCAAGCCCAAGGCCACCAAGACGACGGCTTCACCCAAG
CGCCTGACGCCCGAACAGAAGCAGAAGCACGCTATCCTCTTCCTCCAACGCCTCGCCTTAGTAAAAGAGATGCCC
AAGAACCCGCCCAAGTCGGCTTGGAACGTTTTTATCTCGAGGAAGATAACCAAGGCATCCCCTCTGGCGTCCAGT
ATGGCCGGGCTATCGTCGGCGTTTGCTTCACTCCCAGACGACGCCAAGAGAGTATGTGCTGTCTGCAGCAGTTAC
TCTGTTTCTCTCAAGCTTGTTTTGACTCTTCAATCAGCTGACTTGAGCCTTGCAGGACCTTAACAATGAAGCCGC
GCGCAACAGACATGCCCATGTTGAAAAGCTAAAGGCTTGGGTTCAGGAGTACCCGCCAGAAGCTATTTACGTGGC
CAATCTTGCCCGCCGCCGCCTGTCCCGCAAGTTGAGCAAGAGATTTGCTAAGATTTCAGACCACCGCCTCCCCGC
GCGACCTATTAGCTCCTTTTTTCACTACTACATCAAGCGCCGTGGAGATGGTATTATCGACAGCGACCATGCCGG
CTTTGGCAATGTATCGCGCCAGGTGGGAAGCGAATGGAAATCCCTTGCCCCGAGTGAAAAGAAGAAATATGACGC
CATGTATCAGGAGGATGCAGAGCGCTTCCAGCGCGAATTCAGCACCCTCAAGCCCAAGATAAAGGAATACATCAA
GGCACAAAAGCAAGACTTTGGAAGAACCACGCTCGCCAAATCCACCAAAAAAACTGCGACAGGGAAAGTCTCGAT
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail