Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5480
Gene name
LocationContig_42:129240..131621
Strand+
Gene length (bp)2381
Transcript length (bp)2109
Coding sequence length (bp)2109
Protein length (aa) 703

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01380 SIS SIS domain 2.5E-32 383 510
PF01380 SIS SIS domain 2.9E-24 556 683
PF13522 GATase_6 Glutamine amidotransferase domain 1.6E-16 76 193
PF13537 GATase_7 Glutamine amidotransferase domain 1.2E-09 109 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14742|GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GFA1 PE=1 SV=4 1 702 0.0E+00
sp|P53704|GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GFA1 PE=1 SV=2 1 702 0.0E+00
sp|Q09740|GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.11 PE=3 SV=2 1 702 0.0E+00
sp|Q9Z2Z9|GFPT2_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus GN=Gfpt2 PE=1 SV=3 1 702 0.0E+00
sp|Q4KMC4|GFPT2_RAT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Rattus norvegicus GN=Gfpt2 PE=1 SV=3 1 702 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14742|GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GFA1 PE=1 SV=4 1 702 0.0E+00
sp|P53704|GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GFA1 PE=1 SV=2 1 702 0.0E+00
sp|Q09740|GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.11 PE=3 SV=2 1 702 0.0E+00
sp|Q9Z2Z9|GFPT2_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus GN=Gfpt2 PE=1 SV=3 1 702 0.0E+00
sp|Q4KMC4|GFPT2_RAT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Rattus norvegicus GN=Gfpt2 PE=1 SV=3 1 702 0.0E+00
sp|O94808|GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens GN=GFPT2 PE=1 SV=3 1 702 0.0E+00
sp|P47856|GFPT1_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Mus musculus GN=Gfpt1 PE=1 SV=3 1 702 0.0E+00
sp|Q06210|GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens GN=GFPT1 PE=1 SV=3 1 702 0.0E+00
sp|Q08DQ2|GFPT2_BOVIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Bos taurus GN=GFPT2 PE=2 SV=1 1 702 0.0E+00
sp|P82808|GFPT1_RAT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Rattus norvegicus GN=Gfpt1 PE=1 SV=3 1 702 0.0E+00
sp|B3LLX6|YM084_YEAS1 Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_01975 PE=3 SV=1 1 698 0.0E+00
sp|C7GL41|YM084_YEAS2 Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_01026 PE=3 SV=2 1 698 0.0E+00
sp|Q8SRI2|GFA1_ENCCU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Encephalitozoon cuniculi (strain GB-M1) GN=GFA1 PE=1 SV=1 1 702 0.0E+00
sp|A6ZME2|YM084_YEAS7 Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4254 PE=3 SV=1 1 698 0.0E+00
sp|P0CF18|YM085_YEAST Uncharacterized protein YMR085W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR085W PE=5 SV=1 276 698 2.0E-159
sp|C8ZET8|YM085_YEAS8 Uncharacterized protein EC1118_1M3_2531g OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1M3_2531g PE=5 SV=1 276 698 1.0E-158
sp|Q8KG38|GLMS_CHLTE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glmS PE=3 SV=3 1 702 8.0E-145
sp|Q87TT8|GLMS_PSESM Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glmS PE=3 SV=2 1 702 4.0E-117
sp|Q8KA75|GLMS_BUCAP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glmS PE=3 SV=3 1 702 1.0E-116
sp|Q8NND3|GLMS_CORGL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmS PE=3 SV=2 1 702 2.0E-116
sp|Q8D3J0|GLMS_WIGBR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Wigglesworthia glossinidia brevipalpis GN=glmS PE=3 SV=3 1 702 5.0E-114
sp|P59499|GLMS_BUCBP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=glmS PE=3 SV=2 1 702 3.0E-110
sp|Q8AAB1|GLMS_BACTN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glmS PE=3 SV=2 276 702 5.0E-108
sp|Q8FNH2|GLMS_COREF Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glmS PE=3 SV=3 1 702 1.0E-106
sp|Q5JH71|GLMS_THEKO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glmS PE=3 SV=3 1 702 7.0E-106
sp|Q8PGH9|GLMS_XANAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glmS PE=3 SV=2 1 702 5.0E-103
sp|Q83FU2|GLMS_TROWT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain Twist) GN=glmS PE=3 SV=3 1 702 2.0E-102
sp|Q83IA1|GLMS_TROW8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain TW08/27) GN=glmS PE=3 SV=3 1 702 2.0E-102
sp|Q8PCY1|GLMS_XANCP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glmS PE=3 SV=2 1 702 9.0E-102
sp|Q74GH6|GLMS_GEOSL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 256 702 7.0E-99
sp|O66648|GLMS_AQUAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Aquifex aeolicus (strain VF5) GN=glmS PE=3 SV=3 276 702 5.0E-96
sp|Q6FZH6|GLMS_BARQU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella quintana (strain Toulouse) GN=glmS PE=3 SV=3 276 702 3.0E-92
sp|Q83IY4|GLMS_SHIFL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shigella flexneri GN=glmS PE=3 SV=3 252 702 5.0E-90
sp|Q5PKV9|GLMS_SALPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmS PE=3 SV=3 252 702 6.0E-90
sp|Q8FBT4|GLMS_ECOL6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glmS PE=3 SV=3 252 702 7.0E-90
sp|P17169|GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) GN=glmS PE=1 SV=4 252 702 8.0E-90
sp|Q8Z2Q2|GLMS_SALTI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhi GN=glmS PE=3 SV=3 252 702 1.0E-89
sp|Q8XEG2|GLMS_ECO57 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O157:H7 GN=glmS PE=3 SV=3 252 702 1.0E-89
sp|Q88BX8|GLMS_PSEPK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 252 702 2.0E-89
sp|Q8ZKX1|GLMS_SALTY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmS PE=3 SV=3 252 702 2.0E-89
sp|Q8XHZ7|GLMS_CLOPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 276 702 1.0E-88
sp|Q6G322|GLMS_BARHE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmS PE=3 SV=3 276 702 2.0E-88
sp|Q8R841|GLMS_CALS4 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmS PE=3 SV=3 276 702 3.0E-88
sp|Q72HF4|GLMS_THET2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 276 702 2.0E-87
sp|Q577Y1|GLMS_BRUAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 276 702 5.0E-87
sp|Q8CY30|GLMS_BRUSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 276 702 5.0E-87
sp|Q890U2|GLMS_CLOTE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium tetani (strain Massachusetts / E88) GN=glmS PE=3 SV=2 276 702 1.0E-86
sp|Q8YC47|GLMS_BRUME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 276 702 3.0E-86
sp|Q92DS8|GLMS_LISIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glmS PE=3 SV=3 1 702 3.0E-86
sp|Q5E279|GLMS_VIBF1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glmS PE=3 SV=3 259 702 5.0E-86
sp|P0DB33|GLMS_STRPQ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glmS PE=3 SV=1 1 702 8.0E-86
sp|P0DB32|GLMS_STRP3 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glmS PE=3 SV=1 1 702 8.0E-86
sp|Q8P0S7|GLMS_STRP8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glmS PE=3 SV=2 1 702 1.0E-85
sp|Q6LLH3|GLMS_PHOPR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photobacterium profundum GN=glmS PE=3 SV=3 259 702 1.0E-85
sp|P44708|GLMS_HAEIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glmS PE=3 SV=2 276 702 2.0E-85
sp|Q99ZD3|GLMS_STRP1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M1 GN=glmS PE=3 SV=3 1 702 3.0E-85
sp|Q4J6D9|GLMS_SULAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glmS PE=3 SV=3 1 702 6.0E-85
sp|Q8DEF3|GLMS_VIBVU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain CMCP6) GN=glmS PE=3 SV=3 248 702 1.0E-84
sp|Q8CX33|GLMS_SHEON Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shewanella oneidensis (strain MR-1) GN=glmS PE=3 SV=3 259 702 2.0E-84
sp|Q663R1|GLMS_YERPS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmS PE=3 SV=3 259 702 2.0E-84
sp|Q8Z9S8|GLMS_YERPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pestis GN=glmS PE=3 SV=3 259 702 2.0E-84
sp|Q6CYJ9|GLMS_PECAS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmS PE=3 SV=3 276 702 4.0E-84
sp|Q7MP62|GLMS_VIBVY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain YJ016) GN=glmS PE=3 SV=3 248 702 5.0E-84
sp|P59362|GLMS_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glmS PE=3 SV=2 276 702 5.0E-84
sp|Q9CGT6|GLMS_LACLA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glmS PE=3 SV=2 1 702 6.0E-84
sp|Q56213|GLMS_THET8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 276 702 2.0E-83
sp|Q87SR3|GLMS_VIBPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glmS PE=3 SV=2 259 702 2.0E-83
sp|Q9K1P9|GLMS_NEIMB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup B (strain MC58) GN=glmS PE=3 SV=3 276 702 7.0E-83
sp|P57963|GLMS_PASMU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pasteurella multocida (strain Pm70) GN=glmS PE=3 SV=2 276 702 9.0E-83
sp|Q9JWN9|GLMS_NEIMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glmS PE=3 SV=3 276 702 1.0E-82
sp|Q8DTY0|GLMS_STRMU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmS PE=3 SV=3 1 702 2.0E-82
sp|Q97MN6|GLMS_CLOAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmS PE=3 SV=3 252 702 5.0E-82
sp|Q98LX5|GLMS_RHILO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium loti (strain MAFF303099) GN=glmS PE=3 SV=3 276 702 6.0E-82
sp|Q87F28|GLMS_XYLFT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glmS PE=3 SV=2 276 702 4.0E-81
sp|Q5F584|GLMS_NEIG1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=glmS PE=3 SV=3 276 702 4.0E-81
sp|P57138|GLMS_BUCAI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glmS PE=3 SV=2 262 702 2.0E-80
sp|Q6NG33|GLMS_CORDI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glmS PE=3 SV=3 276 702 2.0E-80
sp|Q9PH05|GLMS_XYLFA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain 9a5c) GN=glmS PE=3 SV=3 276 702 2.0E-80
sp|Q9KUM8|GLMS_VIBCH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glmS PE=3 SV=3 248 702 2.0E-80
sp|P94323|NODM_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 276 702 3.0E-80
sp|Q9HT25|GLMS_PSEAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glmS PE=3 SV=3 252 702 6.0E-80
sp|Q9WXZ5|GLMS_THEMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmS PE=3 SV=3 279 702 3.0E-79
sp|Q8U4D1|GLMS_PYRFU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glmS PE=3 SV=3 217 702 8.0E-79
sp|Q67T12|GLMS_SYMTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glmS PE=3 SV=3 276 702 1.0E-78
sp|Q8Y303|GLMS_RALSO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Ralstonia solanacearum (strain GMI1000) GN=glmS PE=3 SV=3 276 702 2.0E-78
sp|Q7NA97|GLMS_PHOLL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glmS PE=3 SV=3 276 702 4.0E-78
sp|Q58815|GLMS_METJA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmS PE=3 SV=3 85 702 6.0E-78
sp|Q5QZH5|GLMS_IDILO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glmS PE=3 SV=3 276 702 6.0E-78
sp|Q9YCQ6|GLMS_AERPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=glmS PE=3 SV=3 1 702 2.0E-77
sp|O26273|GLMS_METTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glmS PE=3 SV=3 276 702 2.0E-77
sp|Q92ZK3|NODM_RHIME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=nodM PE=3 SV=3 276 702 7.0E-77
sp|Q9ABV2|GLMS_CAUCR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=glmS PE=3 SV=3 276 702 8.0E-77
sp|P08633|NODM_RHILV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 276 702 8.0E-77
sp|Q8UEH1|GLMS_AGRFC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glmS PE=3 SV=3 276 702 9.0E-77
sp|P40831|GLMS_MYCLE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium leprae (strain TN) GN=glmS PE=3 SV=3 276 702 1.0E-76
sp|C8ZET7|YM084_YEAS8 Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1M3_2520g PE=3 SV=1 1 263 2.0E-76
sp|Q7VKK4|GLMS_HAEDU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glmS PE=3 SV=3 262 702 2.0E-76
sp|Q92PS4|GLMS_RHIME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=glmS PE=3 SV=3 276 702 2.0E-76
sp|Q8DJI6|GLMS_THEEB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermosynechococcus elongatus (strain BP-1) GN=glmS PE=3 SV=3 276 702 3.0E-76
sp|A2P2R3|YM084_YEAST Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR084W PE=3 SV=1 1 239 7.0E-76
sp|Q8TZ14|GLMS_METKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glmS PE=3 SV=3 252 702 9.0E-76
sp|O86781|GLMS_STRCO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glmS PE=3 SV=3 276 702 1.0E-75
sp|Q6F6U8|GLMS_ACIAD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glmS PE=3 SV=3 276 702 3.0E-75
sp|Q6AD32|GLMS_LEIXX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmS PE=3 SV=3 276 702 3.0E-75
sp|P9WN49|GLMS_MYCTU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glmS PE=1 SV=1 276 702 5.0E-75
sp|P9WN48|GLMS_MYCTO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glmS PE=3 SV=1 276 702 5.0E-75
sp|P0A589|GLMS_MYCBO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glmS PE=3 SV=2 276 702 5.0E-75
sp|Q5NHQ9|GLMS_FRATT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glmS PE=1 SV=3 276 702 2.0E-74
sp|Q73S23|GLMS_MYCPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glmS PE=3 SV=3 276 702 6.0E-74
sp|Q7NIG8|GLMS_GLOVI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gloeobacter violaceus (strain PCC 7421) GN=glmS PE=3 SV=3 276 702 3.0E-73
sp|Q5ZRP4|GLMS_LEGPH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glmS PE=3 SV=3 276 702 4.0E-73
sp|Q5X153|GLMS_LEGPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Paris) GN=glmS PE=3 SV=3 276 702 6.0E-73
sp|Q8TLL3|GLMS_METAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glmS PE=3 SV=3 276 702 9.0E-73
sp|O68956|GLMS_MYCS2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glmS PE=3 SV=3 276 702 1.0E-72
sp|Q5WSX8|GLMS_LEGPL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Lens) GN=glmS PE=3 SV=3 276 702 1.0E-72
sp|O83833|GLMS_TREPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Treponema pallidum (strain Nichols) GN=glmS PE=3 SV=3 260 702 3.0E-72
sp|Q7VRZ3|GLMS_BORPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmS PE=3 SV=3 276 702 9.0E-72
sp|Q8EZQ1|GLMS_LEPIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glmS PE=3 SV=3 255 702 2.0E-71
sp|Q72V57|GLMS_LEPIC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glmS PE=3 SV=3 255 702 2.0E-71
sp|Q7W334|GLMS_BORPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmS PE=3 SV=3 276 702 3.0E-71
sp|Q7WE36|GLMS_BORBR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmS PE=3 SV=3 276 702 3.0E-71
sp|Q5NRH4|GLMS_ZYMMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmS PE=3 SV=3 234 702 3.0E-71
sp|Q8DRA8|GLMS_STRR6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 278 702 6.0E-71
sp|Q56275|GLMS_ACIFR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acidithiobacillus ferrooxidans GN=glmS PE=3 SV=3 266 702 1.0E-70
sp|Q9HT00|GLMS_HALSA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glmS PE=3 SV=3 275 702 1.0E-70
sp|Q9V249|GLMS_PYRAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glmS PE=3 SV=3 276 702 1.0E-70
sp|P25195|NODM_RHIML Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti GN=nodM PE=2 SV=3 276 702 3.0E-70
sp|Q97SQ9|GLMS_STRPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmS PE=3 SV=3 278 702 9.0E-70
sp|P72720|GLMS_SYNY3 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glmS PE=3 SV=3 276 702 3.0E-69
sp|Q5FUY5|GLMS_GLUOX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 276 702 6.0E-69
sp|O68280|GLMS_NOSS9 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Nostoc sp. (strain PCC 9229) GN=glmS PE=3 SV=3 276 702 2.0E-66
sp|Q8Q038|GLMS_METMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glmS PE=3 SV=2 276 702 3.0E-66
sp|O57981|GLMS_PYRHO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glmS PE=3 SV=3 276 702 3.0E-65
sp|Q8E5P8|GLMS_STRA3 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmS PE=3 SV=3 281 702 4.0E-65
sp|Q8DZZ7|GLMS_STRA5 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmS PE=3 SV=3 281 702 6.0E-65
sp|Q8ETM5|GLMS_OCEIH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmS PE=3 SV=3 248 702 3.0E-64
sp|Q8ZTZ0|GLMS_PYRAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=glmS PE=3 SV=3 278 702 7.0E-64
sp|Q9KG45|GLMS_BACHD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmS PE=3 SV=3 279 702 9.0E-64
sp|Q6HPL2|GLMS_BACHK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmS PE=3 SV=3 279 702 3.0E-63
sp|Q73F49|GLMS_BACC1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmS PE=3 SV=3 279 702 5.0E-63
sp|Q8Y915|GLMS_LISMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmS PE=3 SV=3 279 702 7.0E-63
sp|Q81J01|GLMS_BACCR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmS PE=3 SV=3 279 702 9.0E-63
sp|Q8RG65|GLMS_FUSNN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glmS PE=3 SV=3 252 702 1.0E-62
sp|Q5WLG7|GLMS_BACSK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus clausii (strain KSM-K16) GN=glmS PE=3 SV=3 279 702 2.0E-62
sp|Q722H1|GLMS_LISMF Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmS PE=3 SV=3 279 702 2.0E-62
sp|Q81VN5|GLMS_BACAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus anthracis GN=glmS PE=3 SV=3 279 702 3.0E-62
sp|Q5XBV6|GLMS_STRP6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 281 702 4.0E-62
sp|Q65P46|GLMS_BACLD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmS PE=3 SV=3 279 702 1.0E-61
sp|P64228|GLMS_STAAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain N315) GN=glmS PE=1 SV=2 248 702 8.0E-61
sp|P64227|GLMS_STAAM Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmS PE=3 SV=2 248 702 8.0E-61
sp|Q8NVE6|GLMS_STAAW Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MW2) GN=glmS PE=3 SV=2 214 702 9.0E-61
sp|Q6G7F8|GLMS_STAAS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MSSA476) GN=glmS PE=3 SV=3 214 702 9.0E-61
sp|Q5HE49|GLMS_STAAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain COL) GN=glmS PE=3 SV=3 214 702 9.0E-61
sp|Q6GES3|GLMS_STAAR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MRSA252) GN=glmS PE=3 SV=3 214 702 1.0E-60
sp|Q5L3P0|GLMS_GEOKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacillus kaustophilus (strain HTA426) GN=glmS PE=3 SV=3 279 702 3.0E-60
sp|Q8CRL1|GLMS_STAES Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmS PE=3 SV=3 279 702 3.0E-60
sp|Q5HM69|GLMS_STAEQ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmS PE=3 SV=3 279 702 3.0E-60
sp|Q88YE7|GLMS_LACPL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmS PE=3 SV=2 281 702 8.0E-59
sp|P0CI73|GLMS_BACSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) GN=glmS PE=3 SV=1 279 702 3.0E-56
sp|E0U070|GLMS_BACPZ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=glmS PE=3 SV=1 279 702 8.0E-56
sp|Q9PLA4|GLMS_CHLMU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glmS PE=3 SV=3 276 702 5.0E-54
sp|Q9Z6U0|GLMS_CHLPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia pneumoniae GN=glmS PE=3 SV=4 241 702 2.0E-53
sp|Q9PMT4|GLMS_CAMJE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=glmS PE=3 SV=3 270 702 2.0E-53
sp|O84823|GLMS_CHLTR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmS PE=3 SV=3 276 702 9.0E-53
sp|Q6LWM9|GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) GN=glmS PE=1 SV=2 276 702 2.0E-52
sp|Q821Z7|GLMS_CHLCV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila caviae (strain GPIC) GN=glmS PE=3 SV=3 276 702 4.0E-52
sp|O19908|GLMS_CYACA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Cyanidium caldarium GN=glmS PE=3 SV=3 277 702 3.0E-51
sp|Q5L589|GLMS_CHLAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glmS PE=3 SV=3 276 702 4.0E-48
sp|Q7T6X6|GFAT_MIMIV Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L619 PE=3 SV=4 333 702 9.0E-48
sp|Q9ZJ94|GLMS_HELPJ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glmS PE=3 SV=3 256 702 9.0E-47
sp|O26060|GLMS_HELPY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glmS PE=3 SV=3 256 702 9.0E-47
sp|P44708|GLMS_HAEIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glmS PE=3 SV=2 1 201 7.0E-44
sp|Q7NA97|GLMS_PHOLL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glmS PE=3 SV=3 1 201 7.0E-43
sp|Q663R1|GLMS_YERPS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmS PE=3 SV=3 1 200 9.0E-43
sp|Q8Z9S8|GLMS_YERPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pestis GN=glmS PE=3 SV=3 1 200 9.0E-43
sp|Q5NHQ9|GLMS_FRATT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glmS PE=1 SV=3 1 201 3.0E-42
sp|Q6F6U8|GLMS_ACIAD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glmS PE=3 SV=3 1 201 2.0E-40
sp|Q5QZH5|GLMS_IDILO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glmS PE=3 SV=3 1 201 3.0E-40
sp|P57963|GLMS_PASMU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pasteurella multocida (strain Pm70) GN=glmS PE=3 SV=2 1 201 4.0E-40
sp|Q8DEF3|GLMS_VIBVU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain CMCP6) GN=glmS PE=3 SV=3 1 200 6.0E-40
sp|Q6CYJ9|GLMS_PECAS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmS PE=3 SV=3 1 200 7.0E-40
sp|Q7MP62|GLMS_VIBVY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain YJ016) GN=glmS PE=3 SV=3 1 200 7.0E-40
sp|Q6NG33|GLMS_CORDI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glmS PE=3 SV=3 1 201 2.0E-39
sp|Q97MN6|GLMS_CLOAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmS PE=3 SV=3 1 201 6.0E-39
sp|Q87SR3|GLMS_VIBPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glmS PE=3 SV=2 1 200 9.0E-39
sp|Q8XHZ7|GLMS_CLOPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 1 201 1.0E-38
sp|Q7VKK4|GLMS_HAEDU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glmS PE=3 SV=3 1 200 1.0E-38
sp|Q5E279|GLMS_VIBF1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glmS PE=3 SV=3 1 200 2.0E-38
sp|Q5X153|GLMS_LEGPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Paris) GN=glmS PE=3 SV=3 1 200 2.0E-38
sp|Q5WSX8|GLMS_LEGPL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Lens) GN=glmS PE=3 SV=3 1 200 2.0E-38
sp|Q5ZRP4|GLMS_LEGPH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glmS PE=3 SV=3 1 200 3.0E-38
sp|Q8AAB1|GLMS_BACTN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glmS PE=3 SV=2 1 201 4.0E-38
sp|Q88BX8|GLMS_PSEPK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 1 201 2.0E-37
sp|Q8Z2Q2|GLMS_SALTI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhi GN=glmS PE=3 SV=3 1 201 3.0E-37
sp|Q9KUM8|GLMS_VIBCH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glmS PE=3 SV=3 1 200 3.0E-37
sp|Q5PKV9|GLMS_SALPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmS PE=3 SV=3 1 201 4.0E-37
sp|Q8ZKX1|GLMS_SALTY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmS PE=3 SV=3 1 201 4.0E-37
sp|Q8FBT4|GLMS_ECOL6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glmS PE=3 SV=3 1 201 7.0E-37
sp|Q83IY4|GLMS_SHIFL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shigella flexneri GN=glmS PE=3 SV=3 1 201 1.0E-36
sp|P17169|GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) GN=glmS PE=1 SV=4 1 201 1.0E-36
sp|Q8XEG2|GLMS_ECO57 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O157:H7 GN=glmS PE=3 SV=3 1 201 1.0E-36
sp|Q9HT25|GLMS_PSEAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glmS PE=3 SV=3 1 201 1.0E-36
sp|Q6LLH3|GLMS_PHOPR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photobacterium profundum GN=glmS PE=3 SV=3 1 201 6.0E-36
sp|Q67T12|GLMS_SYMTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glmS PE=3 SV=3 1 201 2.0E-35
sp|Q8DJI6|GLMS_THEEB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermosynechococcus elongatus (strain BP-1) GN=glmS PE=3 SV=3 1 200 3.0E-35
sp|O68956|GLMS_MYCS2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glmS PE=3 SV=3 1 201 4.0E-35
sp|Q8R841|GLMS_CALS4 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmS PE=3 SV=3 1 201 5.0E-35
sp|Q74GH6|GLMS_GEOSL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 1 201 8.0E-35
sp|O66648|GLMS_AQUAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Aquifex aeolicus (strain VF5) GN=glmS PE=3 SV=3 1 201 1.0E-34
sp|Q890U2|GLMS_CLOTE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium tetani (strain Massachusetts / E88) GN=glmS PE=3 SV=2 1 201 1.0E-34
sp|Q6AD32|GLMS_LEIXX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmS PE=3 SV=3 1 201 1.0E-34
sp|P57138|GLMS_BUCAI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glmS PE=3 SV=2 1 204 2.0E-34
sp|P72720|GLMS_SYNY3 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glmS PE=3 SV=3 1 200 3.0E-34
sp|Q6HPL2|GLMS_BACHK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmS PE=3 SV=3 1 201 5.0E-34
sp|Q73F49|GLMS_BACC1 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmS PE=3 SV=3 1 201 5.0E-34
sp|Q81J01|GLMS_BACCR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmS PE=3 SV=3 1 201 5.0E-34
sp|Q81VN5|GLMS_BACAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus anthracis GN=glmS PE=3 SV=3 1 201 5.0E-34
sp|Q9WXZ5|GLMS_THEMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmS PE=3 SV=3 1 201 6.0E-34
sp|Q8Y303|GLMS_RALSO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Ralstonia solanacearum (strain GMI1000) GN=glmS PE=3 SV=3 1 201 6.0E-34
sp|Q8CX33|GLMS_SHEON Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shewanella oneidensis (strain MR-1) GN=glmS PE=3 SV=3 1 200 2.0E-33
sp|Q8Q038|GLMS_METMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glmS PE=3 SV=2 1 201 2.0E-33
sp|O57981|GLMS_PYRHO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glmS PE=3 SV=3 1 201 4.0E-33
sp|Q6LWM9|GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) GN=glmS PE=1 SV=2 1 202 4.0E-33
sp|Q8TLL3|GLMS_METAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glmS PE=3 SV=3 1 201 5.0E-33
sp|Q5L3P0|GLMS_GEOKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacillus kaustophilus (strain HTA426) GN=glmS PE=3 SV=3 1 201 8.0E-33
sp|Q7VRZ3|GLMS_BORPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmS PE=3 SV=3 1 201 9.0E-33
sp|Q7W334|GLMS_BORPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmS PE=3 SV=3 1 201 9.0E-33
sp|Q7WE36|GLMS_BORBR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmS PE=3 SV=3 1 201 9.0E-33
sp|Q8ZTZ0|GLMS_PYRAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=glmS PE=3 SV=3 1 201 1.0E-32
sp|Q821Z7|GLMS_CHLCV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila caviae (strain GPIC) GN=glmS PE=3 SV=3 1 201 1.0E-32
sp|Q5NRH4|GLMS_ZYMMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmS PE=3 SV=3 1 200 2.0E-32
sp|O86781|GLMS_STRCO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glmS PE=3 SV=3 1 201 3.0E-32
sp|Q7NIG8|GLMS_GLOVI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gloeobacter violaceus (strain PCC 7421) GN=glmS PE=3 SV=3 1 200 3.0E-32
sp|P08633|NODM_RHILV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 1 200 4.0E-32
sp|Q5WLG7|GLMS_BACSK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus clausii (strain KSM-K16) GN=glmS PE=3 SV=3 1 201 4.0E-32
sp|Q56206|GLMS_SPHYA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (Fragment) OS=Sphingobium yanoikuyae GN=glmS PE=3 SV=1 559 702 4.0E-32
sp|Q5L589|GLMS_CHLAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glmS PE=3 SV=3 1 201 5.0E-32
sp|P64228|GLMS_STAAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain N315) GN=glmS PE=1 SV=2 1 201 7.0E-32
sp|P64227|GLMS_STAAM Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmS PE=3 SV=2 1 201 7.0E-32
sp|Q8NVE6|GLMS_STAAW Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MW2) GN=glmS PE=3 SV=2 1 201 7.0E-32
sp|Q6G7F8|GLMS_STAAS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MSSA476) GN=glmS PE=3 SV=3 1 201 7.0E-32
sp|Q5HE49|GLMS_STAAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain COL) GN=glmS PE=3 SV=3 1 201 7.0E-32
sp|Q6GES3|GLMS_STAAR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MRSA252) GN=glmS PE=3 SV=3 1 201 8.0E-32
sp|O26060|GLMS_HELPY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glmS PE=3 SV=3 1 200 8.0E-32
sp|Q9V249|GLMS_PYRAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glmS PE=3 SV=3 1 201 1.0E-31
sp|Q9KG45|GLMS_BACHD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmS PE=3 SV=3 1 202 1.0E-31
sp|Q72HF4|GLMS_THET2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 1 201 2.0E-31
sp|Q8U4D1|GLMS_PYRFU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glmS PE=3 SV=3 1 201 2.0E-31
sp|Q56275|GLMS_ACIFR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acidithiobacillus ferrooxidans GN=glmS PE=3 SV=3 1 201 2.0E-31
sp|Q8ETM5|GLMS_OCEIH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmS PE=3 SV=3 1 201 2.0E-31
sp|Q9PMT4|GLMS_CAMJE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=glmS PE=3 SV=3 1 200 2.0E-31
sp|Q56213|GLMS_THET8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 1 201 3.0E-31
sp|Q9Z6U0|GLMS_CHLPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia pneumoniae GN=glmS PE=3 SV=4 1 201 5.0E-31
sp|Q73S23|GLMS_MYCPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glmS PE=3 SV=3 1 201 8.0E-31
sp|Q9ZJ94|GLMS_HELPJ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glmS PE=3 SV=3 1 200 9.0E-31
sp|Q8RG65|GLMS_FUSNN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glmS PE=3 SV=3 1 201 1.0E-30
sp|Q92ZK3|NODM_RHIME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=nodM PE=3 SV=3 1 200 2.0E-30
sp|P9WN49|GLMS_MYCTU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glmS PE=1 SV=1 1 201 2.0E-30
sp|P9WN48|GLMS_MYCTO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glmS PE=3 SV=1 1 201 2.0E-30
sp|P0A589|GLMS_MYCBO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glmS PE=3 SV=2 1 201 2.0E-30
sp|Q8CRL1|GLMS_STAES Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmS PE=3 SV=3 1 201 4.0E-30
sp|Q5HM69|GLMS_STAEQ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmS PE=3 SV=3 1 201 4.0E-30
sp|E0U070|GLMS_BACPZ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=glmS PE=3 SV=1 1 201 6.0E-30
sp|O68280|GLMS_NOSS9 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Nostoc sp. (strain PCC 9229) GN=glmS PE=3 SV=3 1 200 7.0E-30
sp|Q8UEH1|GLMS_AGRFC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glmS PE=3 SV=3 1 200 9.0E-30
sp|Q92PS4|GLMS_RHIME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=glmS PE=3 SV=3 1 200 9.0E-30
sp|Q8TZ14|GLMS_METKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glmS PE=3 SV=3 1 201 1.0E-29
sp|P0CI73|GLMS_BACSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) GN=glmS PE=3 SV=1 1 201 1.0E-29
sp|Q9PLA4|GLMS_CHLMU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glmS PE=3 SV=3 1 201 1.0E-29
sp|O19908|GLMS_CYACA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Cyanidium caldarium GN=glmS PE=3 SV=3 1 200 1.0E-29
sp|Q98LX5|GLMS_RHILO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium loti (strain MAFF303099) GN=glmS PE=3 SV=3 1 200 8.0E-29
sp|P94323|NODM_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 1 200 9.0E-29
sp|Q65P46|GLMS_BACLD Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmS PE=3 SV=3 1 201 9.0E-29
sp|P25195|NODM_RHIML Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti GN=nodM PE=2 SV=3 1 200 1.0E-28
sp|Q6FZH6|GLMS_BARQU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella quintana (strain Toulouse) GN=glmS PE=3 SV=3 1 200 3.0E-28
sp|Q9ABV2|GLMS_CAUCR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=glmS PE=3 SV=3 1 200 5.0E-28
sp|Q8E5P8|GLMS_STRA3 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmS PE=3 SV=3 1 207 5.0E-28
sp|Q9K1P9|GLMS_NEIMB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup B (strain MC58) GN=glmS PE=3 SV=3 1 201 6.0E-28
sp|Q9JWN9|GLMS_NEIMA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glmS PE=3 SV=3 1 201 6.0E-28
sp|P40831|GLMS_MYCLE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium leprae (strain TN) GN=glmS PE=3 SV=3 1 201 6.0E-28
sp|Q87F28|GLMS_XYLFT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glmS PE=3 SV=2 1 201 8.0E-28
sp|Q8DZZ7|GLMS_STRA5 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmS PE=3 SV=3 1 207 1.0E-27
sp|Q9PH05|GLMS_XYLFA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain 9a5c) GN=glmS PE=3 SV=3 1 201 2.0E-27
sp|O84823|GLMS_CHLTR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmS PE=3 SV=3 1 201 2.0E-27
sp|O83833|GLMS_TREPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Treponema pallidum (strain Nichols) GN=glmS PE=3 SV=3 1 201 4.0E-27
sp|Q5FUY5|GLMS_GLUOX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 1 200 4.0E-27
sp|Q6G322|GLMS_BARHE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmS PE=3 SV=3 1 200 5.0E-27
sp|Q8Y915|GLMS_LISMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmS PE=3 SV=3 1 200 6.0E-27
sp|Q88YE7|GLMS_LACPL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmS PE=3 SV=2 1 201 6.0E-27
sp|O26273|GLMS_METTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glmS PE=3 SV=3 1 201 7.0E-27
sp|Q722H1|GLMS_LISMF Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmS PE=3 SV=3 1 200 7.0E-27
sp|Q8CY30|GLMS_BRUSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 1 200 8.0E-26
sp|Q577Y1|GLMS_BRUAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 1 200 1.0E-25
sp|Q8YC47|GLMS_BRUME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 1 200 1.0E-25
sp|Q97SQ9|GLMS_STRPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmS PE=3 SV=3 1 207 1.0E-25
sp|Q8DRA8|GLMS_STRR6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 1 207 2.0E-25
sp|P59362|GLMS_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glmS PE=3 SV=2 1 200 3.0E-25
sp|Q5XBV6|GLMS_STRP6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 1 207 1.0E-24
sp|Q8EZQ1|GLMS_LEPIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glmS PE=3 SV=3 1 200 9.0E-24
sp|Q72V57|GLMS_LEPIC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glmS PE=3 SV=3 1 200 9.0E-24
sp|Q7T6X6|GFAT_MIMIV Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L619 PE=3 SV=4 1 200 5.0E-22
sp|Q9HT00|GLMS_HALSA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glmS PE=3 SV=3 1 200 2.0E-21
sp|Q52846|NODM_RHILT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (Fragment) OS=Rhizobium leguminosarum bv. trifolii GN=nodM PE=3 SV=1 57 147 2.0E-15
sp|Q06203|PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens GN=PPAT PE=1 SV=1 2 200 1.0E-14
sp|P35433|PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus GN=Ppat PE=1 SV=1 2 200 5.0E-14
sp|P28173|PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus GN=PPAT PE=2 SV=1 2 200 5.0E-14
sp|Q57657|PUR1_METJA Amidophosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purF PE=3 SV=3 1 200 1.0E-13
sp|Q27601|PUR1_DROME Amidophosphoribosyltransferase OS=Drosophila melanogaster GN=Prat PE=1 SV=2 2 146 2.0E-10
sp|Q9L6B8|PUR1_PASMU Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 1 223 5.0E-10
sp|P00497|PUR1_BACSU Amidophosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=purF PE=1 SV=2 2 179 1.0E-09
sp|Q9V253|PUR1_PYRAB Amidophosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purF PE=3 SV=1 2 200 2.0E-09
sp|O57979|PUR1_PYRHO Amidophosphoribosyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purF PE=3 SV=1 2 179 4.0E-09
sp|P43854|PUR1_HAEIN Amidophosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purF PE=3 SV=2 1 223 2.0E-08
sp|O32157|FRLB_BACSU Fructosamine deglycase FrlB OS=Bacillus subtilis (strain 168) GN=frlB PE=1 SV=1 389 652 2.0E-08
sp|O26293|Y191_METTH Putative glutamine amidotransferase MTH_191 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_191 PE=3 SV=3 48 144 2.0E-08
sp|O26742|PUR1_METTH Amidophosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purF PE=3 SV=1 2 219 5.0E-08
sp|P99164|PUR1_STAAN Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=purF PE=1 SV=1 2 200 4.0E-07
sp|P65831|PUR1_STAAM Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purF PE=3 SV=1 2 200 4.0E-07
sp|Q6GI14|PUR1_STAAR Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purF PE=3 SV=1 2 200 5.0E-07
sp|Q8NX91|PUR1_STAAW Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=purF PE=3 SV=1 2 200 7.0E-07
sp|Q6GAE3|PUR1_STAAS Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purF PE=3 SV=1 2 200 7.0E-07
sp|Q5HH14|PUR1_STAAC Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=purF PE=3 SV=1 2 200 7.0E-07
sp|P0AG17|PUR1_SHIFL Amidophosphoribosyltransferase OS=Shigella flexneri GN=purF PE=3 SV=2 1 246 1.0E-06
sp|P0AG16|PUR1_ECOLI Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) GN=purF PE=1 SV=2 1 246 1.0E-06
sp|Q55621|PUR1_SYNY3 Amidophosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purF PE=3 SV=1 2 201 2.0E-06
sp|O87390|GLXB_RHIME Glutamine amidotransferase-like protein GlxB OS=Rhizobium meliloti (strain 1021) GN=glxB PE=3 SV=3 53 145 3.0E-06
sp|Q55038|PUR1_SYNE7 Amidophosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=purF PE=3 SV=1 2 145 4.0E-06
sp|Q1AYD7|MURQ_RUBXD N-acetylmuramic acid 6-phosphate etherase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=murQ PE=3 SV=1 332 509 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0097367 carbohydrate derivative binding Yes
GO:1901135 carbohydrate derivative metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5480
MCGIFGYINYLVEKDRKFILDTLINGLSRLEYRGYDSAGLAVDGDKKNEVFAFKEVGKVAKLKKLIDESHINLKK
VFDSHAGIAHTRWATHGPPSTTNCHPHRSDVHWEFTVVHNGIITNYKELKTLLISKGFKFETETDTECIAKLTKY
IHDQHPQIGFTDLAKAVIQELEGAYGLLIKSVHYPHEVIAARKGSPLVIGVKTQRRMKVDFVDVEYADDNTALPA
EAASQNVALKKNAPDFLSPTASLLGAPDKSLLHRSQSRAFMTDDGMPMPTEFFLSSDPSAIVEHTKKVMYLEDDD
IAHIHEGSLNIHRLRKADGSSNVRTIQTLELELQEIMKGKFDHFMQKEIFEQPESVVNTMRGRLDIANKTVTLGG
LRSYISTIRRCRRIIFIACGTSYHSCMAVRGIFEELAEIPISVELASDFLDRQAPVFRDDTCVFVSQSGETADSL
MALRYCLERGALTVGIVNVVGSSISLLTHCGVHVNAGPEIGVASTKAYTSQFIAMVMFALSLSEDRASKKARQEE
IMEGLSRVSEQIKQILELDKPIKEMCQKVFKNQKSLLLLGRGSQFSTALEGALKIKEISYLHCEAVMSGELKHGV
LALVDENMPIIMVLTRDDIFKKSLNAYQQVIARGGKPIVICNTGDEEFKASDAEKIEVPKTVDCLQGLLNVIPLQ
LIAYWLAVLEGLNVDFPRNLAKSVTVE*
Coding >OphauB2|5480
ATGTGTGGCATCTTCGGCTACATCAACTATTTGGTGGAAAAGGATCGCAAATTCATTCTTGACACACTCATCAAT
GGGCTCTCTCGTCTCGAGTACCGAGGCTACGACTCGGCCGGTCTGGCCGTTGATGGCGACAAGAAGAACGAGGTG
TTTGCCTTCAAGGAGGTGGGCAAGGTAGCCAAGCTCAAGAAGCTCATCGACGAGTCGCATATCAACCTTAAGAAA
GTATTTGACTCGCACGCCGGCATCGCCCACACCCGGTGGGCCACCCATGGCCCTCCTTCCACCACCAACTGCCAC
CCTCATCGATCCGATGTGCACTGGGAATTCACCGTAGTGCACAATGGCATCATTACAAATTATAAAGAGCTCAAG
ACGCTGCTCATTAGCAAAGGCTTCAAGTTTGAAACTGAAACCGATACCGAGTGCATCGCCAAGCTGACAAAGTAT
ATCCACGACCAGCATCCTCAAATTGGCTTCACCGACTTGGCCAAGGCGGTCATTCAGGAGCTCGAGGGTGCCTAT
GGTCTTCTCATCAAATCGGTGCACTACCCCCACGAGGTTATTGCCGCCCGCAAGGGTTCCCCCTTGGTTATTGGC
GTCAAGACACAGCGCCGCATGAAGGTCGATTTTGTCGACGTCGAATACGCCGACGACAATACGGCTCTGCCGGCC
GAGGCGGCCTCACAGAACGTGGCGCTCAAGAAGAATGCGCCCGACTTCCTCAGCCCTACCGCTAGTCTTCTTGGC
GCCCCAGACAAGTCGCTTTTGCACCGCTCCCAGTCGCGTGCCTTTATGACGGATGACGGCATGCCCATGCCCACT
GAATTCTTCCTCTCCTCCGATCCTTCTGCCATCGTCGAGCATACCAAAAAGGTTATGTACCTCGAGGATGACGAT
ATTGCCCATATCCACGAGGGTTCTCTCAACATTCACAGACTGAGAAAGGCTGATGGCAGCTCCAATGTGCGCACC
ATTCAGACTCTGGAACTCGAACTGCAGGAGATCATGAAGGGCAAGTTTGATCACTTCATGCAAAAGGAAATCTTT
GAGCAGCCCGAGTCGGTCGTCAACACCATGCGTGGCCGTCTCGACATTGCCAACAAGACTGTTACGCTGGGAGGT
CTCCGATCCTACATTTCGACAATTCGTCGCTGCCGTCGAATCATCTTCATTGCCTGCGGCACGAGCTACCACTCC
TGTATGGCGGTGCGTGGTATCTTCGAAGAGCTTGCCGAGATACCCATTTCGGTTGAGCTAGCCTCGGACTTCCTC
GATAGACAGGCTCCAGTTTTCCGCGATGACACGTGTGTCTTTGTTTCACAATCTGGAGAGACGGCAGACTCGCTC
ATGGCTCTGCGCTACTGCCTCGAGCGTGGTGCCTTGACAGTTGGCATCGTCAATGTCGTGGGCTCCTCCATCTCG
CTCCTTACTCACTGCGGTGTGCACGTCAACGCGGGCCCGGAAATTGGTGTCGCCTCCACCAAGGCTTATACATCA
CAGTTTATTGCCATGGTCATGTTTGCCTTGTCACTCAGCGAAGATCGCGCCTCCAAGAAGGCGCGCCAGGAGGAG
ATTATGGAGGGCTTGTCTCGTGTCTCAGAGCAGATTAAGCAAATTCTCGAGCTGGACAAGCCCATCAAGGAAATG
TGTCAAAAGGTCTTCAAGAACCAAAAGTCGCTTCTTCTCCTCGGTCGGGGTAGCCAATTCTCCACTGCACTCGAG
GGTGCACTCAAGATCAAGGAAATTTCATATCTTCACTGCGAGGCCGTCATGTCTGGCGAGCTCAAGCATGGCGTT
TTGGCCTTGGTGGACGAGAACATGCCCATCATCATGGTTTTGACTCGCGACGATATTTTCAAGAAGTCACTCAAT
GCCTACCAGCAGGTAATTGCCCGTGGCGGCAAGCCCATTGTAATTTGCAACACGGGCGACGAAGAGTTCAAGGCT
TCGGATGCCGAGAAGATTGAAGTGCCCAAGACGGTCGACTGCTTGCAGGGTCTGCTCAACGTTATTCCGTTGCAG
CTGATTGCCTACTGGCTTGCAGTCCTCGAGGGCCTCAACGTCGACTTTCCCCGCAATCTGGCCAAGTCGGTCACG
GTTGAGTAA
Transcript >OphauB2|5480
ATGTGTGGCATCTTCGGCTACATCAACTATTTGGTGGAAAAGGATCGCAAATTCATTCTTGACACACTCATCAAT
GGGCTCTCTCGTCTCGAGTACCGAGGCTACGACTCGGCCGGTCTGGCCGTTGATGGCGACAAGAAGAACGAGGTG
TTTGCCTTCAAGGAGGTGGGCAAGGTAGCCAAGCTCAAGAAGCTCATCGACGAGTCGCATATCAACCTTAAGAAA
GTATTTGACTCGCACGCCGGCATCGCCCACACCCGGTGGGCCACCCATGGCCCTCCTTCCACCACCAACTGCCAC
CCTCATCGATCCGATGTGCACTGGGAATTCACCGTAGTGCACAATGGCATCATTACAAATTATAAAGAGCTCAAG
ACGCTGCTCATTAGCAAAGGCTTCAAGTTTGAAACTGAAACCGATACCGAGTGCATCGCCAAGCTGACAAAGTAT
ATCCACGACCAGCATCCTCAAATTGGCTTCACCGACTTGGCCAAGGCGGTCATTCAGGAGCTCGAGGGTGCCTAT
GGTCTTCTCATCAAATCGGTGCACTACCCCCACGAGGTTATTGCCGCCCGCAAGGGTTCCCCCTTGGTTATTGGC
GTCAAGACACAGCGCCGCATGAAGGTCGATTTTGTCGACGTCGAATACGCCGACGACAATACGGCTCTGCCGGCC
GAGGCGGCCTCACAGAACGTGGCGCTCAAGAAGAATGCGCCCGACTTCCTCAGCCCTACCGCTAGTCTTCTTGGC
GCCCCAGACAAGTCGCTTTTGCACCGCTCCCAGTCGCGTGCCTTTATGACGGATGACGGCATGCCCATGCCCACT
GAATTCTTCCTCTCCTCCGATCCTTCTGCCATCGTCGAGCATACCAAAAAGGTTATGTACCTCGAGGATGACGAT
ATTGCCCATATCCACGAGGGTTCTCTCAACATTCACAGACTGAGAAAGGCTGATGGCAGCTCCAATGTGCGCACC
ATTCAGACTCTGGAACTCGAACTGCAGGAGATCATGAAGGGCAAGTTTGATCACTTCATGCAAAAGGAAATCTTT
GAGCAGCCCGAGTCGGTCGTCAACACCATGCGTGGCCGTCTCGACATTGCCAACAAGACTGTTACGCTGGGAGGT
CTCCGATCCTACATTTCGACAATTCGTCGCTGCCGTCGAATCATCTTCATTGCCTGCGGCACGAGCTACCACTCC
TGTATGGCGGTGCGTGGTATCTTCGAAGAGCTTGCCGAGATACCCATTTCGGTTGAGCTAGCCTCGGACTTCCTC
GATAGACAGGCTCCAGTTTTCCGCGATGACACGTGTGTCTTTGTTTCACAATCTGGAGAGACGGCAGACTCGCTC
ATGGCTCTGCGCTACTGCCTCGAGCGTGGTGCCTTGACAGTTGGCATCGTCAATGTCGTGGGCTCCTCCATCTCG
CTCCTTACTCACTGCGGTGTGCACGTCAACGCGGGCCCGGAAATTGGTGTCGCCTCCACCAAGGCTTATACATCA
CAGTTTATTGCCATGGTCATGTTTGCCTTGTCACTCAGCGAAGATCGCGCCTCCAAGAAGGCGCGCCAGGAGGAG
ATTATGGAGGGCTTGTCTCGTGTCTCAGAGCAGATTAAGCAAATTCTCGAGCTGGACAAGCCCATCAAGGAAATG
TGTCAAAAGGTCTTCAAGAACCAAAAGTCGCTTCTTCTCCTCGGTCGGGGTAGCCAATTCTCCACTGCACTCGAG
GGTGCACTCAAGATCAAGGAAATTTCATATCTTCACTGCGAGGCCGTCATGTCTGGCGAGCTCAAGCATGGCGTT
TTGGCCTTGGTGGACGAGAACATGCCCATCATCATGGTTTTGACTCGCGACGATATTTTCAAGAAGTCACTCAAT
GCCTACCAGCAGGTAATTGCCCGTGGCGGCAAGCCCATTGTAATTTGCAACACGGGCGACGAAGAGTTCAAGGCT
TCGGATGCCGAGAAGATTGAAGTGCCCAAGACGGTCGACTGCTTGCAGGGTCTGCTCAACGTTATTCCGTTGCAG
CTGATTGCCTACTGGCTTGCAGTCCTCGAGGGCCTCAACGTCGACTTTCCCCGCAATCTGGCCAAGTCGGTCACG
GTTGAGTAA
Gene >OphauB2|5480
ATGTGGTACGTCTGCCGACCCCACCCCAACCTGCTAGGGCTCCAAATACTTGGCCTCTTGACTCAATTGATGCGC
GTGGCTCACCAAGAGGCTTGTAGTGGCATCTTCGGCTACATCAACTATTTGGTGGAAAAGGATCGCAAATTCATT
CTTGACACACTCATCAATGGTTAGTCTGTCCAATTCTCTGCCCCATAAGCTGCCCATGCCCCGCCTAATGCCAAT
TCGTCTGGATAAGGGCTCTCTCGTCTCGAGTACCGAGGCTACGACTCGGCCGGTCTGGCCGTTGATGGCGACAAG
AAGAACGAGGTGTTTGCCTTCAAGGAGGTGGGCAAGGTAGCCAAGCTCAAGAAGCTCATCGACGAGTCGCATATC
AACCTTAAGAAAGTATTTGACTCGCACGCCGGCATCGCCCACACCCGGTGGGCCACCCATGGCCCTCCTTCCACC
ACCAACTGCCACCCTCATCGGTACGTCTCAGTTCGAGACAGACGCACCCTGTGCCATGGCTGATTGGCCTTCTGC
AGATCCGATGTGCACTGGGAATTCACCGTAGTGCACAATGGCATCATTACAAATTATAAAGAGCTCAAGACGCTG
CTCATTAGCAAAGGCTTCAAGTTTGAAACTGAAACCGATACCGAGTGCATCGCCAAGCTGACAAAGTATATCCAC
GACCAGCATCCTCAAATTGGCTTCACCGACTTGGCCAAGGCGGTCATTCAGGAGCTCGAGGGTGCCTATGGTCTT
CTCATCAAATCGGTGCACTACCCCCACGAGGTTATTGCCGCCCGCAAGGGTTCCCCCTTGGTTATTGGCGTCAAG
ACACAGCGCCGCATGAAGGTCGATTTTGTCGACGTCGAATACGCCGACGACAATACGGCTCTGCCGGCCGAGGCG
GCCTCACAGAACGTGGCGCTCAAGAAGAATGCGCCCGACTTCCTCAGCCCTACCGCTAGTCTTCTTGGCGCCCCA
GACAAGTCGCTTTTGCACCGCTCCCAGTCGCGTGCCTTTATGACGGATGACGGCATGCCCATGCCCACTGAATTC
TTCCTCTCCTCCGATCCTTCTGCCATCGTCGAGCATACCAAAAAGGTTATGTACCTCGAGGATGACGATATTGCC
CATATCCACGAGGGTTCTCTCAACATTCACAGACTGAGAAAGGCTGATGGCAGCTCCAATGTGCGCACCATTCAG
ACTCTGGAACTCGAACTGCAGGAGATCATGAAGGGCAAGTTTGATCACTTCATGCAAAAGGAAATCTTTGAGCAG
CCCGAGTCGGTCGTCAACACCATGCGTGGCCGTCTCGACATTGCCAACAAGACTGTTACGCTGGGAGGTCTCCGA
TCCTACATTTCGACAATTCGTCGCTGCCGTCGAATCATCTTCATTGCCTGCGGCACGAGCTACCACTCCTGTATG
GCGGTGCGTGGTATCTTCGAAGAGCTTGCCGAGATACCCATTTCGGTTGAGCTAGCCTCGGACTTCCTCGATAGA
CAGGCTCCAGTTTTCCGCGATGACACGTGTGTCTTTGTTTCACAATCTGGAGAGACGGCAGACTCGCTCATGGCT
CTGCGCTACTGCCTCGAGCGTGGTGCCTTGACAGTTGGCATCGTCAATGTCGTGGGCTCCTCCATCTCGCTCCTT
ACTCACTGCGGTGTGCACGTCAACGCGGGCCCGGAAATTGGTGTCGCCTCCACCAAGGCTTATACATCACAGTTT
ATTGCCATGGTCATGTTTGCCTTGTCACTCAGCGAAGATCGCGCCTCCAAGAAGGCGCGCCAGGAGGAGATTATG
GAGGGCTTGTCTCGTGTCTCAGAGCAGATTAAGCAAATTCTCGAGCTGGACAAGCCCATCAAGGAAATGTGTCAA
AAGGTCTTCAAGAACCAAAAGTCGCTTCTTCTCCTCGGTCGGGGTAGCCAATTCTCCACTGCACTCGAGGGTGCA
CTCAAGATCAAGGAAATTTCATATCTTCACTGCGAGGCCGTCATGTCTGGCGAGCTCAAGCATGGCGTTTTGGCC
TTGGTGGACGAGAACATGCCCATCATCATGGTTTTGACTCGCGACGATATTTTCAAGAAGTCACTCAATGCCTAC
CAGCAGGGTAAGTTTGGTGTTTGCATGGCATTGAGACAATGACACTAATTAATTTGTTAGTAATTGCCCGTGGCG
GCAAGCCCATTGTAATTTGCAACACGGGCGACGAAGAGTTCAAGGCTTCGGATGCCGAGAAGATTGAAGTGCCCA
AGACGGTCGACTGCTTGCAGGGTCTGCTCAACGTTATTCCGTTGCAGCTGATTGCCTACTGGCTTGCAGTCCTCG
AGGGCCTCAACGTCGACTTTCCCCGCAATCTGGCCAAGTCGGTCACGGTTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail