Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5476
Gene name
LocationContig_42:116171..122688
Strand-
Gene length (bp)6517
Transcript length (bp)6429
Coding sequence length (bp)6429
Protein length (aa) 2143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18995 PRT6_C Proteolysis_6 C-terminal 1.2E-149 1645 2117
PF02207 zf-UBR Putative zinc finger in N-recognin (UBR box) 3.6E-15 87 153
PF02617 ClpS ATP-dependent Clp protease adaptor protein ClpS 6.5E-07 235 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60152|UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr1 PE=3 SV=1 574 2142 0.0E+00
sp|O13731|UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr11 PE=3 SV=1 3 2132 0.0E+00
sp|Q8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens GN=UBR1 PE=1 SV=1 591 2112 3.0E-76
sp|O70481|UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus GN=Ubr1 PE=1 SV=2 591 2112 4.0E-75
sp|O60152|UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr1 PE=3 SV=1 10 355 5.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60152|UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr1 PE=3 SV=1 574 2142 0.0E+00
sp|O13731|UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr11 PE=3 SV=1 3 2132 0.0E+00
sp|Q8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens GN=UBR1 PE=1 SV=1 591 2112 3.0E-76
sp|O70481|UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus GN=Ubr1 PE=1 SV=2 591 2112 4.0E-75
sp|O60152|UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr1 PE=3 SV=1 10 355 5.0E-64
sp|Q6WKZ8|UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus GN=Ubr2 PE=1 SV=2 588 1573 3.0E-53
sp|Q8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens GN=UBR2 PE=1 SV=1 588 1573 3.0E-53
sp|P19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBR1 PE=1 SV=1 578 1571 5.0E-48
sp|O60014|UBR1_KLULA E3 ubiquitin-protein ligase UBR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBR1 PE=3 SV=2 549 1541 2.0E-45
sp|Q9VX91|UBR1_DROME E3 ubiquitin-protein ligase UBR1 OS=Drosophila melanogaster GN=Ubr1 PE=2 SV=2 591 1541 3.0E-42
sp|Q07963|UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBR2 PE=1 SV=1 932 1540 5.0E-31
sp|P91133|UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans GN=ubr-1 PE=1 SV=2 578 1542 7.0E-26
sp|Q6WKZ8|UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus GN=Ubr2 PE=1 SV=2 1978 2109 1.0E-21
sp|Q8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens GN=UBR2 PE=1 SV=1 1985 2112 3.0E-21
sp|O60014|UBR1_KLULA E3 ubiquitin-protein ligase UBR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBR1 PE=3 SV=2 84 327 3.0E-19
sp|P91133|UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans GN=ubr-1 PE=1 SV=2 1946 2140 6.0E-19
sp|Q5U430|UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus GN=Ubr3 PE=1 SV=3 1882 2109 6.0E-18
sp|P19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBR1 PE=1 SV=1 84 326 1.0E-17
sp|P91133|UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans GN=ubr-1 PE=1 SV=2 34 279 2.0E-17
sp|Q9VX91|UBR1_DROME E3 ubiquitin-protein ligase UBR1 OS=Drosophila melanogaster GN=Ubr1 PE=2 SV=2 1993 2109 5.0E-17
sp|O70481|UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus GN=Ubr1 PE=1 SV=2 87 278 2.0E-16
sp|Q6ZT12|UBR3_HUMAN E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens GN=UBR3 PE=2 SV=2 1883 2112 2.0E-16
sp|Q8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens GN=UBR1 PE=1 SV=1 87 278 1.0E-15
sp|F4KCC2|PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana GN=PRT6 PE=2 SV=1 1883 2112 1.0E-13
sp|Q6ZT12|UBR3_HUMAN E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens GN=UBR3 PE=2 SV=2 619 1191 8.0E-13
sp|Q5U430|UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus GN=Ubr3 PE=1 SV=3 619 1239 9.0E-13
sp|Q8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens GN=UBR2 PE=1 SV=1 87 359 4.0E-11
sp|F4KCC2|PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana GN=PRT6 PE=2 SV=1 917 1417 1.0E-10
sp|Q07963|UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBR2 PE=1 SV=1 1981 2142 5.0E-10
sp|Q6WKZ8|UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus GN=Ubr2 PE=1 SV=2 87 283 7.0E-10
sp|Q9VX91|UBR1_DROME E3 ubiquitin-protein ligase UBR1 OS=Drosophila melanogaster GN=Ubr1 PE=2 SV=2 80 312 8.0E-10
sp|F4KCC2|PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana GN=PRT6 PE=2 SV=1 87 155 2.0E-09
sp|Q6ZT12|UBR3_HUMAN E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens GN=UBR3 PE=2 SV=2 1313 1575 6.0E-06
sp|Q6ZT12|UBR3_HUMAN E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens GN=UBR3 PE=2 SV=2 87 155 7.0E-06
sp|Q5U430|UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus GN=Ubr3 PE=1 SV=3 87 155 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030163 protein catabolic process Yes
GO:0008270 zinc ion binding Yes
GO:1901565 organonitrogen compound catabolic process No
GO:1901575 organic substance catabolic process No
GO:0046914 transition metal ion binding No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5476
MDAPLSTQEQQLCQFLAELPARFDFRYTEDASKELLRNLFWSMAGGNHGYMGLLFPTGRLADSLKLREAQGAVEG
AEYTEAARGKRCGHIFKPGEASYVCRTCGTDETCCLCSRCFDSTDHSGHMVRMQLSVGNSGCCDCGDDEAWTHRL
LCIVHSDIDTGPDKGKAKQAAALPDEFLASLRMTVARAFDYICDVVSCSPEQLRQAKSQESILKDEESSRLSSKY
YGAQGPPCTEFALVLWNDEKHTVQDVQDQVARACSKTMREASRNALETDLVGRSILTYSTDIAQLLKMAKIMEAI
RVTVTIRAARDTFREQMCGTLVEWLSDISGCTAGHDSHILRQTVCEQAMRPWRQGSRATHTLGLIDDEEEDEQSM
SSSTLHGVNAHFILALQRAAGTTNVEIAIETGAVMTGDDEDGDEEEEEEIDEVEQDDDEVEVDDDADMDDGEDGN
HSVSSSAAVLDEDQDVMMVDARGDVTDLGMNWSQSDQALEEDEATMAGYPRPPPPPPPPAQTRGAGRERDGTPSD
SDTADGLIAPAMSAKANAKIPKTPGKTRLLTPRPAKYWVETPQVYTQRGNVPPAEDVFQRVRLDWLLYFDLRLWK
KVRNDLRSLYISTVVQMPEFKRVLALRFASLYTVLAQLYLVGDREPDHSVINLSLQMLTTPSITAEVVERGNFMS
SLFAILYTFLTTRQVGHPWDVSPEAVLAFESGSVTNRRTYHFYQDLKFLLGSQHVQERIRCEPRYLMQFLDLGKL
HQGMGPNVRAVAEHVEYEPESWITTSMVTRQMSLQARNVAEAFRNCPADEIHYLQRAIRFTTKTVIINSVGAERH
RFKQAEINDEVRFKTLGDFEFDSEATSYQVVKFVVDRESISFHHALHHTLSWLIECARGLPASNLRTLMSFSLQE
LKSPPRLMGRPQLPKKEYEPEDYLMAAFDYPLRVCAWLAQIKASMWVRNGISLRHQAGTYRGVGQRDVTHHRDIF
LLQTAMVVCNPSRVLCSIMDRFGMDGWVKGIFELKSEAQDDVQHLDVVEDMVHLLIVLVSDRTSLMAPEDEANSR
LLAMRRDIIHVLCFKPLSFNEICNKLPDKYQEQQEFYMALDELATFKPPEGTSDVGTFELRHEFIEDIDPYISHY
NKNQREEAELAYRRKMANKTGKTLDEIVYEPKQRPIPSGLFQGLGAFTGTGVFAQIIYYSLLYPLVAHKLTATVP
VTRLEAFVQVVLHLMLIAIVEDKTVEDKTDEATQEQGSFVYTALTKMARSNFMPEASNSRTIVSLLHLLSTRQEF
KSAQAKIALVLKRLKQKRPQAFESAFASLGIAADRISTASPASTGGEEERERKKKAALSRQAKVMAQFQQQQKSF
LEKQGGMDWGSDVDEDDEAKQQQTEERKHDWKFPRGTCILCQEEVDDQLLYGTFALLAESRMLRQTDFQDASLVR
EASQTPCSLDRSADEVRPFGMAQENRKMVEKLNWRGEKFLAERQTIGRGYAGDLSRPGPLASGCGHMMHYHCFEV
YYEATNSRHTHQIARHHPEMMALNEFVCPLCKARGNVFLPIIWKGMQESYPGRLQARMSFADLLEHQVALDKWPG
QGAEPGAMDAMTPPRAAPPPPWERLMSVAPLMMPATALCLPIGRDGSRGVDGANLNMNIMNELENAYARLKESVR
LNKLDKRYDEAQVDDGAQLDLTEMLVYTVAFTLSSVELQQRGVEAQPGMTLLERIPEQTITQLRVLAETASALIT
VRGRFGSFDNLMGERRFRQSCQLFISRHLAMEPPKLRRLMNLYPPLLSLDPFIFLVECTYGLGSVQSVDVKHLLS
LCYLAELVKVVYHMSRNMNMSKWLEALQQRQTHDEAINNFADFALAVTEYGMCDDEPTLHAQRANEAFDQPGVDS
LQAWYSFVKKYALVFLRKSLLLLYIKYGIDFNSFVSSNAEADELHRLTEAMMLPSFDQMCASLTSKSLACGWPET
IRDVVLGWVKHQVLGSNKPSQVRQTAIVSHPGIFELIGLPKTYDTLIEEASRRKCPTTGKDVMDPAICLFCGEMV
CSQSTCCQKLCTVGNESVKLGGGQQHMRRCQRNIGVFLNIRKCTIIFFFNQSGSFAAAPYMDRYGETDYQLRHGR
QLFLSQKRYDSMIRNAVVNNDVPAFVSRRLELDVNNGGWDTL*
Coding >OphauB2|5476
ATGGATGCTCCATTGTCGACTCAAGAGCAGCAGCTCTGCCAGTTCCTGGCGGAGCTTCCGGCACGATTCGATTTT
CGCTACACGGAAGATGCGTCAAAGGAACTGCTGCGAAACCTGTTTTGGTCCATGGCGGGCGGGAATCACGGCTAC
ATGGGCCTTCTCTTCCCCACAGGCAGACTGGCCGACTCGCTCAAGCTGCGCGAGGCCCAAGGGGCGGTGGAAGGG
GCTGAGTACACAGAGGCGGCTCGCGGGAAACGATGCGGCCACATCTTCAAGCCGGGCGAGGCCTCATATGTTTGC
AGAACCTGCGGGACGGACGAGACGTGCTGTCTTTGCAGCAGATGCTTCGACTCGACGGACCACTCGGGCCACATG
GTTCGCATGCAGCTGTCGGTTGGCAACAGTGGTTGTTGCGACTGCGGAGATGACGAGGCTTGGACACATCGCTTG
CTGTGCATCGTCCACTCGGACATAGACACAGGGCCCGACAAGGGCAAGGCCAAGCAAGCTGCTGCCCTGCCCGAC
GAGTTCTTGGCAAGCCTCCGCATGACTGTTGCCAGAGCCTTTGACTACATCTGCGACGTTGTCTCGTGCTCGCCC
GAGCAGCTGCGCCAGGCCAAGTCGCAGGAATCCATTCTCAAAGACGAAGAGTCGTCTCGCTTGTCTTCCAAGTAC
TATGGCGCTCAGGGTCCGCCATGCACCGAGTTTGCTCTGGTGCTGTGGAACGACGAGAAGCACACGGTGCAGGAT
GTTCAAGACCAAGTGGCTAGGGCTTGCAGCAAGACGATGCGTGAGGCGTCACGCAATGCCCTAGAAACAGACTTG
GTTGGGCGGAGCATCTTGACGTACTCGACGGATATTGCTCAACTGCTCAAAATGGCCAAAATCATGGAGGCAATC
CGAGTGACAGTGACGATTCGAGCAGCCAGGGATACGTTTCGTGAACAAATGTGCGGCACACTGGTTGAGTGGCTG
AGCGACATCTCGGGCTGCACCGCTGGCCACGATAGTCATATTCTGCGGCAGACTGTGTGCGAGCAGGCCATGCGG
CCGTGGAGGCAGGGAAGCCGAGCAACACATACGCTGGGTCTTATAGACGACGAAGAAGAGGACGAACAGAGCATG
AGCTCGAGTACGCTCCATGGGGTGAATGCCCACTTCATCCTGGCTCTGCAGCGAGCTGCTGGTACCACGAATGTG
GAAATCGCAATTGAGACGGGCGCTGTCATGACGGGCGACGATGAGGATGGTGATGAGGAGGAGGAGGAGGAAATA
GACGAGGTTGAACAGGATGACGACGAGGTGGAGGTGGACGACGACGCCGACATGGATGACGGCGAGGATGGGAAC
CATTCAGTTTCAAGCTCGGCGGCTGTCTTGGACGAGGACCAAGACGTCATGATGGTGGACGCCAGGGGCGATGTG
ACTGACCTGGGCATGAATTGGAGCCAGTCGGACCAGGCGCTGGAAGAGGACGAGGCAACCATGGCAGGCTATCCG
CGACCGCCGCCACCGCCACCGCCGCCGGCACAGACAAGAGGCGCAGGGCGGGAGCGCGACGGAACTCCGTCCGAC
TCGGACACGGCCGACGGGCTGATTGCGCCTGCCATGTCGGCCAAGGCCAACGCCAAGATACCCAAGACGCCGGGA
AAGACGAGGCTGCTGACGCCGCGGCCAGCAAAGTACTGGGTGGAGACGCCCCAGGTGTACACGCAGCGCGGCAAT
GTGCCTCCGGCCGAGGACGTTTTCCAGCGCGTGCGCCTCGACTGGCTGCTGTACTTTGACCTGCGCCTGTGGAAA
AAGGTGCGCAACGACCTGCGGTCGCTCTACATTTCGACAGTGGTGCAGATGCCCGAGTTCAAGCGCGTCTTGGCC
CTTCGCTTTGCCAGCCTCTACACGGTGCTGGCCCAGCTGTACCTGGTGGGCGACCGAGAGCCAGATCACTCCGTC
ATCAATCTCTCGCTCCAGATGCTGACGACGCCGTCCATCACGGCCGAGGTTGTTGAGCGAGGCAACTTTATGAGC
AGCTTGTTTGCAATCCTCTACACCTTCTTGACTACTCGGCAGGTGGGCCATCCGTGGGATGTGTCGCCCGAGGCC
GTCCTGGCCTTTGAGAGCGGCTCCGTGACGAACCGGCGAACCTACCACTTTTACCAGGACCTCAAGTTCCTCCTC
GGCTCGCAGCACGTGCAGGAGCGCATCAGGTGCGAGCCTCGCTATCTGATGCAGTTTCTCGACCTCGGCAAGCTA
CACCAGGGCATGGGGCCCAACGTGCGGGCGGTGGCGGAGCACGTTGAATACGAGCCCGAGTCTTGGATCACTACC
TCGATGGTGACGCGACAAATGAGCCTCCAGGCACGCAATGTGGCCGAGGCGTTCCGCAATTGCCCTGCCGACGAG
ATTCATTACCTGCAGCGCGCCATTCGCTTCACGACCAAGACGGTCATCATCAACTCGGTGGGAGCAGAGCGGCAT
CGATTCAAGCAGGCCGAGATCAATGACGAGGTCAGGTTCAAGACGCTGGGCGACTTTGAATTCGACAGCGAGGCC
ACGTCGTATCAAGTGGTCAAGTTTGTCGTGGACAGGGAGTCGATTAGCTTCCACCATGCACTGCACCACACGCTG
TCGTGGCTCATCGAGTGCGCCAGAGGCCTGCCTGCATCTAATCTGAGGACGCTCATGAGCTTCAGCTTGCAGGAG
CTCAAGTCGCCGCCCAGATTGATGGGCCGGCCGCAGCTGCCCAAGAAGGAGTATGAGCCCGAAGACTACCTCATG
GCGGCCTTTGATTACCCGCTTCGAGTGTGCGCCTGGCTGGCCCAAATCAAGGCCAGCATGTGGGTGCGCAATGGC
ATCAGTCTTCGGCACCAGGCGGGCACCTATCGCGGCGTGGGGCAAAGAGACGTGACGCACCATCGCGACATTTTC
CTCCTCCAGACAGCCATGGTGGTTTGCAACCCCAGCCGGGTCCTTTGCTCCATCATGGACCGCTTCGGCATGGAT
GGCTGGGTCAAGGGCATCTTTGAGCTCAAGTCGGAGGCGCAAGACGATGTGCAGCATCTCGATGTTGTCGAGGAC
ATGGTGCACCTGCTCATTGTGCTTGTCAGTGACCGGACCTCGCTCATGGCTCCCGAGGACGAGGCCAACTCGCGC
TTGCTTGCCATGCGCCGAGACATTATCCACGTCTTGTGTTTTAAGCCGCTCTCCTTCAACGAGATATGCAACAAG
CTGCCCGACAAGTACCAGGAGCAACAAGAGTTTTACATGGCGCTCGACGAGCTGGCCACGTTCAAGCCGCCCGAG
GGCACGTCGGACGTGGGCACCTTTGAGCTTCGGCACGAGTTTATTGAGGACATTGATCCCTACATTTCGCACTAC
AACAAGAACCAGCGCGAGGAGGCGGAGCTGGCGTATAGAAGGAAAATGGCAAACAAGACGGGCAAGACGCTTGAC
GAGATTGTCTATGAGCCAAAGCAGCGGCCAATTCCATCGGGCTTGTTCCAGGGGCTGGGCGCGTTTACGGGCACG
GGCGTCTTTGCGCAGATTATCTACTACTCGCTCCTGTACCCCTTGGTTGCACACAAGCTGACGGCGACGGTGCCT
GTGACGAGGCTGGAGGCGTTTGTCCAGGTGGTGCTGCACCTGATGCTCATTGCCATTGTCGAGGACAAGACGGTC
GAGGACAAGACGGACGAGGCAACGCAGGAGCAAGGCTCCTTTGTCTATACGGCACTGACCAAGATGGCGCGCAGC
AACTTCATGCCCGAAGCCAGCAACTCGCGGACCATTGTCTCGCTGCTGCACCTGCTCTCGACGCGGCAAGAGTTC
AAGTCTGCACAGGCCAAGATTGCCCTGGTGCTGAAGCGACTCAAGCAGAAGCGGCCGCAGGCTTTTGAGAGTGCC
TTTGCCAGCCTGGGCATTGCCGCGGACCGCATAAGCACGGCCTCTCCAGCCAGCACGGGAGGCGAGGAGGAACGC
GAGCGCAAGAAGAAGGCGGCGCTGAGCCGGCAGGCCAAGGTGATGGCGCAGTTTCAGCAGCAGCAAAAGAGCTTT
CTCGAGAAGCAGGGAGGCATGGACTGGGGCTCGGATGTGGACGAGGACGACGAGGCCAAGCAGCAGCAGACGGAG
GAGCGCAAGCATGACTGGAAGTTCCCGCGTGGCACGTGCATTCTGTGCCAGGAGGAGGTGGACGACCAGCTCCTC
TATGGCACCTTTGCTCTCTTGGCCGAGAGCCGCATGCTGCGCCAGACCGACTTCCAGGACGCCAGCCTGGTGCGC
GAGGCGTCGCAGACGCCCTGCAGCCTGGACCGCTCAGCCGACGAGGTGCGGCCGTTTGGCATGGCGCAGGAAAAC
CGCAAAATGGTGGAGAAGCTGAATTGGCGGGGGGAAAAGTTTCTGGCTGAGCGGCAAACAATTGGCAGAGGCTAT
GCCGGCGACTTGTCGAGGCCCGGGCCCCTGGCCAGCGGGTGTGGGCATATGATGCACTACCACTGCTTCGAGGTC
TACTACGAGGCGACCAACAGCCGGCACACGCACCAGATTGCCCGCCACCACCCCGAGATGATGGCGCTCAACGAG
TTTGTGTGCCCGCTGTGCAAGGCGCGCGGCAACGTCTTCTTGCCCATTATCTGGAAGGGCATGCAAGAGTCGTAC
CCGGGCAGGCTGCAGGCGCGCATGTCGTTTGCCGACTTGCTGGAGCACCAAGTGGCCCTGGACAAGTGGCCGGGC
CAGGGCGCCGAGCCGGGAGCCATGGACGCCATGACGCCTCCGAGGGCCGCGCCGCCGCCGCCCTGGGAACGCCTC
ATGAGCGTGGCGCCCCTCATGATGCCGGCCACTGCTCTTTGCCTGCCCATTGGCCGTGACGGCTCGCGCGGCGTC
GATGGTGCAAACCTCAACATGAACATTATGAATGAGCTCGAGAATGCCTATGCGCGCCTCAAGGAAAGCGTCCGC
CTCAACAAGCTTGACAAGCGATATGACGAGGCCCAGGTGGACGACGGCGCCCAGCTCGACTTGACCGAGATGCTC
GTCTACACCGTGGCCTTTACCCTGTCGTCGGTCGAGTTGCAGCAGCGCGGCGTCGAGGCTCAGCCCGGCATGACG
CTGCTCGAGAGGATACCCGAGCAGACAATTACCCAGCTGAGAGTGCTTGCTGAGACTGCCTCTGCCCTCATCACC
GTCAGGGGCCGCTTCGGCAGCTTTGACAACCTCATGGGCGAGCGCCGCTTCCGCCAGTCGTGCCAGCTCTTCATC
TCACGCCATCTCGCCATGGAGCCGCCCAAGCTGCGCCGTCTGATGAACCTGTATCCGCCCTTGCTGAGTCTGGAC
CCCTTCATCTTCTTGGTCGAGTGCACCTATGGCCTGGGCTCGGTCCAGTCAGTCGACGTGAAGCACCTGCTTAGC
CTGTGCTATCTGGCCGAGCTGGTCAAGGTTGTCTACCACATGAGCCGAAACATGAACATGTCGAAATGGCTCGAG
GCCCTGCAGCAGCGGCAGACCCACGACGAGGCCATCAACAACTTTGCCGACTTTGCCCTTGCCGTGACCGAGTAC
GGCATGTGTGACGACGAGCCGACGCTGCATGCCCAGAGGGCCAATGAGGCCTTTGACCAGCCGGGCGTCGACTCC
CTGCAGGCATGGTACTCGTTTGTCAAGAAGTACGCCCTTGTCTTTTTGCGCAAGAGCCTCTTGCTGCTCTACATC
AAGTACGGCATCGACTTTAACAGCTTTGTCTCCTCCAATGCCGAGGCGGACGAACTGCACCGCCTGACCGAGGCC
ATGATGCTGCCCTCGTTTGACCAAATGTGTGCTAGCTTGACGAGCAAGTCTTTGGCCTGTGGCTGGCCAGAGACA
ATACGAGATGTTGTCCTTGGCTGGGTCAAGCACCAGGTGCTGGGAAGCAACAAGCCAAGCCAAGTACGCCAGACG
GCCATTGTCAGCCACCCAGGCATTTTCGAGCTTATAGGTCTTCCCAAGACGTATGACACCCTCATTGAGGAGGCC
AGTCGCAGAAAGTGTCCCACGACGGGCAAGGACGTCATGGACCCCGCCATCTGTCTATTTTGCGGCGAAATGGTT
TGCAGCCAGAGCACCTGTTGCCAGAAGCTCTGCACAGTGGGCAACGAGTCGGTTAAACTGGGCGGAGGACAGCAA
CACATGCGGCGGTGCCAACGCAACATTGGCGTCTTCCTCAACATTCGCAAGTGCACCATCATTTTCTTCTTTAAC
CAGTCGGGGTCGTTTGCGGCAGCGCCTTATATGGATCGCTATGGCGAGACGGATTACCAACTGCGGCACGGGCGA
CAGCTCTTCCTAAGCCAGAAGAGGTATGACTCGATGATTCGAAACGCCGTCGTGAATAACGATGTTCCCGCTTTT
GTCAGCCGCCGGCTAGAGCTAGACGTTAACAATGGAGGATGGGACACTCTGTGA
Transcript >OphauB2|5476
ATGGATGCTCCATTGTCGACTCAAGAGCAGCAGCTCTGCCAGTTCCTGGCGGAGCTTCCGGCACGATTCGATTTT
CGCTACACGGAAGATGCGTCAAAGGAACTGCTGCGAAACCTGTTTTGGTCCATGGCGGGCGGGAATCACGGCTAC
ATGGGCCTTCTCTTCCCCACAGGCAGACTGGCCGACTCGCTCAAGCTGCGCGAGGCCCAAGGGGCGGTGGAAGGG
GCTGAGTACACAGAGGCGGCTCGCGGGAAACGATGCGGCCACATCTTCAAGCCGGGCGAGGCCTCATATGTTTGC
AGAACCTGCGGGACGGACGAGACGTGCTGTCTTTGCAGCAGATGCTTCGACTCGACGGACCACTCGGGCCACATG
GTTCGCATGCAGCTGTCGGTTGGCAACAGTGGTTGTTGCGACTGCGGAGATGACGAGGCTTGGACACATCGCTTG
CTGTGCATCGTCCACTCGGACATAGACACAGGGCCCGACAAGGGCAAGGCCAAGCAAGCTGCTGCCCTGCCCGAC
GAGTTCTTGGCAAGCCTCCGCATGACTGTTGCCAGAGCCTTTGACTACATCTGCGACGTTGTCTCGTGCTCGCCC
GAGCAGCTGCGCCAGGCCAAGTCGCAGGAATCCATTCTCAAAGACGAAGAGTCGTCTCGCTTGTCTTCCAAGTAC
TATGGCGCTCAGGGTCCGCCATGCACCGAGTTTGCTCTGGTGCTGTGGAACGACGAGAAGCACACGGTGCAGGAT
GTTCAAGACCAAGTGGCTAGGGCTTGCAGCAAGACGATGCGTGAGGCGTCACGCAATGCCCTAGAAACAGACTTG
GTTGGGCGGAGCATCTTGACGTACTCGACGGATATTGCTCAACTGCTCAAAATGGCCAAAATCATGGAGGCAATC
CGAGTGACAGTGACGATTCGAGCAGCCAGGGATACGTTTCGTGAACAAATGTGCGGCACACTGGTTGAGTGGCTG
AGCGACATCTCGGGCTGCACCGCTGGCCACGATAGTCATATTCTGCGGCAGACTGTGTGCGAGCAGGCCATGCGG
CCGTGGAGGCAGGGAAGCCGAGCAACACATACGCTGGGTCTTATAGACGACGAAGAAGAGGACGAACAGAGCATG
AGCTCGAGTACGCTCCATGGGGTGAATGCCCACTTCATCCTGGCTCTGCAGCGAGCTGCTGGTACCACGAATGTG
GAAATCGCAATTGAGACGGGCGCTGTCATGACGGGCGACGATGAGGATGGTGATGAGGAGGAGGAGGAGGAAATA
GACGAGGTTGAACAGGATGACGACGAGGTGGAGGTGGACGACGACGCCGACATGGATGACGGCGAGGATGGGAAC
CATTCAGTTTCAAGCTCGGCGGCTGTCTTGGACGAGGACCAAGACGTCATGATGGTGGACGCCAGGGGCGATGTG
ACTGACCTGGGCATGAATTGGAGCCAGTCGGACCAGGCGCTGGAAGAGGACGAGGCAACCATGGCAGGCTATCCG
CGACCGCCGCCACCGCCACCGCCGCCGGCACAGACAAGAGGCGCAGGGCGGGAGCGCGACGGAACTCCGTCCGAC
TCGGACACGGCCGACGGGCTGATTGCGCCTGCCATGTCGGCCAAGGCCAACGCCAAGATACCCAAGACGCCGGGA
AAGACGAGGCTGCTGACGCCGCGGCCAGCAAAGTACTGGGTGGAGACGCCCCAGGTGTACACGCAGCGCGGCAAT
GTGCCTCCGGCCGAGGACGTTTTCCAGCGCGTGCGCCTCGACTGGCTGCTGTACTTTGACCTGCGCCTGTGGAAA
AAGGTGCGCAACGACCTGCGGTCGCTCTACATTTCGACAGTGGTGCAGATGCCCGAGTTCAAGCGCGTCTTGGCC
CTTCGCTTTGCCAGCCTCTACACGGTGCTGGCCCAGCTGTACCTGGTGGGCGACCGAGAGCCAGATCACTCCGTC
ATCAATCTCTCGCTCCAGATGCTGACGACGCCGTCCATCACGGCCGAGGTTGTTGAGCGAGGCAACTTTATGAGC
AGCTTGTTTGCAATCCTCTACACCTTCTTGACTACTCGGCAGGTGGGCCATCCGTGGGATGTGTCGCCCGAGGCC
GTCCTGGCCTTTGAGAGCGGCTCCGTGACGAACCGGCGAACCTACCACTTTTACCAGGACCTCAAGTTCCTCCTC
GGCTCGCAGCACGTGCAGGAGCGCATCAGGTGCGAGCCTCGCTATCTGATGCAGTTTCTCGACCTCGGCAAGCTA
CACCAGGGCATGGGGCCCAACGTGCGGGCGGTGGCGGAGCACGTTGAATACGAGCCCGAGTCTTGGATCACTACC
TCGATGGTGACGCGACAAATGAGCCTCCAGGCACGCAATGTGGCCGAGGCGTTCCGCAATTGCCCTGCCGACGAG
ATTCATTACCTGCAGCGCGCCATTCGCTTCACGACCAAGACGGTCATCATCAACTCGGTGGGAGCAGAGCGGCAT
CGATTCAAGCAGGCCGAGATCAATGACGAGGTCAGGTTCAAGACGCTGGGCGACTTTGAATTCGACAGCGAGGCC
ACGTCGTATCAAGTGGTCAAGTTTGTCGTGGACAGGGAGTCGATTAGCTTCCACCATGCACTGCACCACACGCTG
TCGTGGCTCATCGAGTGCGCCAGAGGCCTGCCTGCATCTAATCTGAGGACGCTCATGAGCTTCAGCTTGCAGGAG
CTCAAGTCGCCGCCCAGATTGATGGGCCGGCCGCAGCTGCCCAAGAAGGAGTATGAGCCCGAAGACTACCTCATG
GCGGCCTTTGATTACCCGCTTCGAGTGTGCGCCTGGCTGGCCCAAATCAAGGCCAGCATGTGGGTGCGCAATGGC
ATCAGTCTTCGGCACCAGGCGGGCACCTATCGCGGCGTGGGGCAAAGAGACGTGACGCACCATCGCGACATTTTC
CTCCTCCAGACAGCCATGGTGGTTTGCAACCCCAGCCGGGTCCTTTGCTCCATCATGGACCGCTTCGGCATGGAT
GGCTGGGTCAAGGGCATCTTTGAGCTCAAGTCGGAGGCGCAAGACGATGTGCAGCATCTCGATGTTGTCGAGGAC
ATGGTGCACCTGCTCATTGTGCTTGTCAGTGACCGGACCTCGCTCATGGCTCCCGAGGACGAGGCCAACTCGCGC
TTGCTTGCCATGCGCCGAGACATTATCCACGTCTTGTGTTTTAAGCCGCTCTCCTTCAACGAGATATGCAACAAG
CTGCCCGACAAGTACCAGGAGCAACAAGAGTTTTACATGGCGCTCGACGAGCTGGCCACGTTCAAGCCGCCCGAG
GGCACGTCGGACGTGGGCACCTTTGAGCTTCGGCACGAGTTTATTGAGGACATTGATCCCTACATTTCGCACTAC
AACAAGAACCAGCGCGAGGAGGCGGAGCTGGCGTATAGAAGGAAAATGGCAAACAAGACGGGCAAGACGCTTGAC
GAGATTGTCTATGAGCCAAAGCAGCGGCCAATTCCATCGGGCTTGTTCCAGGGGCTGGGCGCGTTTACGGGCACG
GGCGTCTTTGCGCAGATTATCTACTACTCGCTCCTGTACCCCTTGGTTGCACACAAGCTGACGGCGACGGTGCCT
GTGACGAGGCTGGAGGCGTTTGTCCAGGTGGTGCTGCACCTGATGCTCATTGCCATTGTCGAGGACAAGACGGTC
GAGGACAAGACGGACGAGGCAACGCAGGAGCAAGGCTCCTTTGTCTATACGGCACTGACCAAGATGGCGCGCAGC
AACTTCATGCCCGAAGCCAGCAACTCGCGGACCATTGTCTCGCTGCTGCACCTGCTCTCGACGCGGCAAGAGTTC
AAGTCTGCACAGGCCAAGATTGCCCTGGTGCTGAAGCGACTCAAGCAGAAGCGGCCGCAGGCTTTTGAGAGTGCC
TTTGCCAGCCTGGGCATTGCCGCGGACCGCATAAGCACGGCCTCTCCAGCCAGCACGGGAGGCGAGGAGGAACGC
GAGCGCAAGAAGAAGGCGGCGCTGAGCCGGCAGGCCAAGGTGATGGCGCAGTTTCAGCAGCAGCAAAAGAGCTTT
CTCGAGAAGCAGGGAGGCATGGACTGGGGCTCGGATGTGGACGAGGACGACGAGGCCAAGCAGCAGCAGACGGAG
GAGCGCAAGCATGACTGGAAGTTCCCGCGTGGCACGTGCATTCTGTGCCAGGAGGAGGTGGACGACCAGCTCCTC
TATGGCACCTTTGCTCTCTTGGCCGAGAGCCGCATGCTGCGCCAGACCGACTTCCAGGACGCCAGCCTGGTGCGC
GAGGCGTCGCAGACGCCCTGCAGCCTGGACCGCTCAGCCGACGAGGTGCGGCCGTTTGGCATGGCGCAGGAAAAC
CGCAAAATGGTGGAGAAGCTGAATTGGCGGGGGGAAAAGTTTCTGGCTGAGCGGCAAACAATTGGCAGAGGCTAT
GCCGGCGACTTGTCGAGGCCCGGGCCCCTGGCCAGCGGGTGTGGGCATATGATGCACTACCACTGCTTCGAGGTC
TACTACGAGGCGACCAACAGCCGGCACACGCACCAGATTGCCCGCCACCACCCCGAGATGATGGCGCTCAACGAG
TTTGTGTGCCCGCTGTGCAAGGCGCGCGGCAACGTCTTCTTGCCCATTATCTGGAAGGGCATGCAAGAGTCGTAC
CCGGGCAGGCTGCAGGCGCGCATGTCGTTTGCCGACTTGCTGGAGCACCAAGTGGCCCTGGACAAGTGGCCGGGC
CAGGGCGCCGAGCCGGGAGCCATGGACGCCATGACGCCTCCGAGGGCCGCGCCGCCGCCGCCCTGGGAACGCCTC
ATGAGCGTGGCGCCCCTCATGATGCCGGCCACTGCTCTTTGCCTGCCCATTGGCCGTGACGGCTCGCGCGGCGTC
GATGGTGCAAACCTCAACATGAACATTATGAATGAGCTCGAGAATGCCTATGCGCGCCTCAAGGAAAGCGTCCGC
CTCAACAAGCTTGACAAGCGATATGACGAGGCCCAGGTGGACGACGGCGCCCAGCTCGACTTGACCGAGATGCTC
GTCTACACCGTGGCCTTTACCCTGTCGTCGGTCGAGTTGCAGCAGCGCGGCGTCGAGGCTCAGCCCGGCATGACG
CTGCTCGAGAGGATACCCGAGCAGACAATTACCCAGCTGAGAGTGCTTGCTGAGACTGCCTCTGCCCTCATCACC
GTCAGGGGCCGCTTCGGCAGCTTTGACAACCTCATGGGCGAGCGCCGCTTCCGCCAGTCGTGCCAGCTCTTCATC
TCACGCCATCTCGCCATGGAGCCGCCCAAGCTGCGCCGTCTGATGAACCTGTATCCGCCCTTGCTGAGTCTGGAC
CCCTTCATCTTCTTGGTCGAGTGCACCTATGGCCTGGGCTCGGTCCAGTCAGTCGACGTGAAGCACCTGCTTAGC
CTGTGCTATCTGGCCGAGCTGGTCAAGGTTGTCTACCACATGAGCCGAAACATGAACATGTCGAAATGGCTCGAG
GCCCTGCAGCAGCGGCAGACCCACGACGAGGCCATCAACAACTTTGCCGACTTTGCCCTTGCCGTGACCGAGTAC
GGCATGTGTGACGACGAGCCGACGCTGCATGCCCAGAGGGCCAATGAGGCCTTTGACCAGCCGGGCGTCGACTCC
CTGCAGGCATGGTACTCGTTTGTCAAGAAGTACGCCCTTGTCTTTTTGCGCAAGAGCCTCTTGCTGCTCTACATC
AAGTACGGCATCGACTTTAACAGCTTTGTCTCCTCCAATGCCGAGGCGGACGAACTGCACCGCCTGACCGAGGCC
ATGATGCTGCCCTCGTTTGACCAAATGTGTGCTAGCTTGACGAGCAAGTCTTTGGCCTGTGGCTGGCCAGAGACA
ATACGAGATGTTGTCCTTGGCTGGGTCAAGCACCAGGTGCTGGGAAGCAACAAGCCAAGCCAAGTACGCCAGACG
GCCATTGTCAGCCACCCAGGCATTTTCGAGCTTATAGGTCTTCCCAAGACGTATGACACCCTCATTGAGGAGGCC
AGTCGCAGAAAGTGTCCCACGACGGGCAAGGACGTCATGGACCCCGCCATCTGTCTATTTTGCGGCGAAATGGTT
TGCAGCCAGAGCACCTGTTGCCAGAAGCTCTGCACAGTGGGCAACGAGTCGGTTAAACTGGGCGGAGGACAGCAA
CACATGCGGCGGTGCCAACGCAACATTGGCGTCTTCCTCAACATTCGCAAGTGCACCATCATTTTCTTCTTTAAC
CAGTCGGGGTCGTTTGCGGCAGCGCCTTATATGGATCGCTATGGCGAGACGGATTACCAACTGCGGCACGGGCGA
CAGCTCTTCCTAAGCCAGAAGAGGTATGACTCGATGATTCGAAACGCCGTCGTGAATAACGATGTTCCCGCTTTT
GTCAGCCGCCGGCTAGAGCTAGACGTTAACAATGGAGGATGGGACACTCTGTGA
Gene >OphauB2|5476
ATGGATGCTCCATTGTCGACTCAAGAGCAGCAGCTCTGCCAGTTCCTGGCGGAGCTTCCGGCACGATTCGATTTT
CGCTACACGGAAGATGCGTCAAAGGAACTGCTGCGAAACCTGTTTTGGTCCATGGCGGGCGGGAATCACGGCTAC
ATGGGCCTTCTCTTCCCCACAGGCAGACTGGCCGACTCGCTCAAGCTGCGCGAGGCCCAAGGGGCGGTGGAAGGG
GCTGAGTACACAGAGGCGGCTCGCGGGAAACGATGCGGCCACATCTTCAAGCCGGGCGAGGCCTCATATGTTTGC
AGAACCTGCGGGACGGACGAGACGTGCTGTCTTTGCAGCAGATGCTTCGACTCGACGGACCACTCGGGCCACATG
GTTCGCATGCAGCTGTCGGTTGGCAACAGTGGTTGTTGCGACTGCGGAGATGACGAGGCTTGGACACATCGCTTG
CTGTGCATCGTCCACTCGGACATAGACACAGGGCCCGACAAGGGCAAGGCCAAGCAAGCTGCTGCCCTGCCCGAC
GAGTTCTTGGCAAGCCTCCGCATGACTGTTGCCAGAGCCTTTGACTACATCTGCGACGTTGTCTCGTGCTCGCCC
GAGCAGCTGCGCCAGGCCAAGTCGCAGGAATCCATTCTCAAAGACGAAGAGTCGTCTCGCTTGTCTTCCAAGTAC
TATGGCGCTCAGGGTCCGCCATGCACCGAGTTTGCTCTGGTGCTGTGGAACGACGAGAAGCACACGGTGCAGGAT
GTTCAAGACCAAGTGGCTAGGGCTTGCAGCAAGACGATGCGTGAGGCGTCACGCAATGCCCTAGAAACAGACTTG
GTTGGGCGGAGCATCTTGACGTACTCGACGGATATTGCTCAACTGCTCAAAATGGCCAAAATCATGGAGGCAATC
CGAGTGACAGTGACGATTCGAGCAGCCAGGGATACGTTTCGTGAACAAATGTGCGGCACACTGGTTGAGTGGCTG
AGCGACATCTCGGGCTGCACCGCTGGCCACGATAGTCATATTCTGCGGCAGACTGTGTGCGAGCAGGCCATGCGG
CCGTGGAGGCAGGGAAGCCGAGCAACACATACGCTGGGTCTTATAGACGACGAAGAAGAGGACGAACAGAGCATG
AGCTCGAGTACGCTCCATGGGGTGAATGCCCACTTCATCCTGGCTCTGCAGCGAGCTGCTGGTACCACGAATGTG
GAAATCGCAATTGAGACGGGCGCTGTCATGACGGGCGACGATGAGGATGGTGATGAGGAGGAGGAGGAGGAAATA
GACGAGGTTGAACAGGATGACGACGAGGTGGAGGTGGACGACGACGCCGACATGGATGACGGCGAGGATGGGAAC
CATTCAGTTTCAAGCTCGGCGGCTGTCTTGGACGAGGACCAAGACGTCATGATGGTGGACGCCAGGGGCGATGTG
ACTGACCTGGGCATGAATTGGAGCCAGTCGGACCAGGCGCTGGAAGAGGACGAGGCAACCATGGCAGGCTATCCG
CGACCGCCGCCACCGCCACCGCCGCCGGCACAGACAAGAGGCGCAGGGCGGGAGCGCGACGGAACTCCGTCCGAC
TCGGACACGGCCGACGGGCTGATTGCGCCTGCCATGTCGGCCAAGGCCAACGCCAAGATACCCAAGACGCCGGGA
AAGACGAGGCTGCTGACGCCGCGGCCAGCAAAGTACTGGGTGGAGACGCCCCAGGTGTACACGCAGCGCGGCAAT
GTGCCTCCGGCCGAGGACGTTTTCCAGCGCGTGCGCCTCGACTGGCTGCTGTACTTTGACCTGCGCCTGTGGAAA
AAGGTGCGCAACGACCTGCGGTCGCTCTACATTTCGACAGTGGTGCAGATGCCCGAGTTCAAGCGCGTCTTGGCC
CTTCGCTTTGCCAGCCTCTACACGGTGCTGGCCCAGCTGTACCTGGTGGGCGACCGAGAGCCAGATCACTCCGTC
ATCAATCTCTCGCTCCAGATGCTGACGACGCCGTCCATCACGGCCGAGGTTGTTGAGCGAGGCAACTTTATGAGC
AGCTTGTTTGCAATCCTCTACACCTTCTTGACTACTCGGCAGGTGGGCCATCCGTGGGATGTGTCGCCCGAGGCC
GTCCTGGCCTTTGAGAGCGGCTCCGTGACGAACCGGCGAACCTACCACTTTTACCAGGACCTCAAGTTCCTCCTC
GGCTCGCAGCACGTGCAGGAGCGCATCAGGTGCGAGCCTCGCTATCTGATGCAGTTTCTCGACCTCGGCAAGCTA
CACCAGGGCATGGGGCCCAACGTGCGGGCGGTGGCGGAGCACGTTGAATACGAGCCCGAGTCTTGGATCACTACC
TCGATGGTGACGCGACAAATGAGCCTCCAGGCACGCAATGTGGCCGAGGCGTTCCGCAATTGCCCTGCCGACGAG
ATTCATTACCTGCAGCGCGCCATTCGCTTCACGACCAAGACGGTCATCATCAACTCGGTGGGAGCAGAGCGGCAT
CGATTCAAGCAGGCCGAGATCAATGACGAGGTCAGGTTCAAGACGCTGGGCGACTTTGAATTCGACAGCGAGGCC
ACGTCGTATCAAGTGGTCAAGTTTGTCGTGGACAGGGAGTCGATTAGCTTCCACCATGCACTGCACCACACGCTG
TCGTGGCTCATCGAGTGCGCCAGAGGCCTGCCTGCATCTAATCTGAGGACGCTCATGAGCTTCAGCTTGCAGGAG
CTCAAGTCGCCGCCCAGATTGATGGGCCGGCCGCAGCTGCCCAAGAAGGAGTATGAGCCCGAAGACTACCTCATG
GCGGCCTTTGATTACCCGCTTCGAGTGTGCGCCTGGCTGGCCCAAATCAAGGCCAGCATGTGGGTGCGCAATGGC
ATCAGTCTTCGGCACCAGGCGGGCACCTATCGCGGCGTGGGGCAAAGAGACGTGACGCACCATCGCGACATTTTC
CTCCTCCAGACAGCCATGGTGGTTTGCAACCCCAGCCGGGTCCTTTGCTCCATCATGGACCGCTTCGGCATGGAT
GGCTGGGTCAAGGGCATCTTTGAGCTCAAGTCGGAGGCGCAAGACGATGTGCAGCATCTCGATGTTGTCGAGGAC
ATGGTGCACCTGCTCATTGTGCTTGTCAGTGACCGGACCTCGCTCATGGCTCCCGAGGACGAGGCCAACTCGCGC
TTGCTTGCCATGCGCCGAGACATTATCCACGTCTTGTGTTTTAAGCCGCTCTCCTTCAACGAGATATGCAACAAG
CTGCCCGACAAGTACCAGGAGCAACAAGAGTTTTACATGGCGCTCGACGAGCTGGCCACGTTCAAGCCGCCCGAG
GGCACGTCGGACGTGGGCACCTTTGAGCTTCGGCACGAGTTTATTGAGGACATTGATCCCTACATTTCGCACTAC
AACAAGAACCAGCGCGAGGAGGCGGAGCTGGCGTATAGAAGGAAAATGGCAAACAAGACGGGCAAGACGCTTGAC
GAGATTGTCTATGAGCCAAAGCAGCGGCCAATTCCATCGGGCTTGTTCCAGGGGCTGGGCGCGTTTACGGGCACG
GGCGTCTTTGCGCAGATTATCTACTACTCGCTCCTGTACCCCTTGGTTGCACACAAGCTGACGGCGACGGTGCCT
GTGACGAGGCTGGAGGCGTTTGTCCAGGTGGTGCTGCACCTGATGCTCATTGCCATTGTCGAGGACAAGACGGTC
GAGGACAAGACGGACGAGGCAACGCAGGAGCAAGGCTCCTTTGTCTATACGGCACTGACCAAGATGGCGCGCAGC
AACTTCATGCCCGAAGCCAGCAACTCGCGGACCATTGTCTCGCTGCTGCACCTGCTCTCGACGCGGCAAGAGTTC
AAGTCTGCACAGGCCAAGATTGCCCTGGTGCTGAAGCGACTCAAGCAGAAGCGGCCGCAGGCTTTTGAGAGTGCC
TTTGCCAGCCTGGGCATTGCCGCGGACCGCATAAGCACGGCCTCTCCAGCCAGCACGGGAGGCGAGGAGGAACGC
GAGCGCAAGAAGAAGGCGGCGCTGAGCCGGCAGGCCAAGGTGATGGCGCAGTTTCAGCAGCAGCAAAAGAGCTTT
CTCGAGAAGCAGGGAGGCATGGACTGGGGCTCGGATGTGGACGAGGACGACGAGGCCAAGCAGCAGCAGACGGAG
GAGCGCAAGCATGACTGGAAGTTCCCGCGTGGCACGTGCATTCTGTGCCAGGAGGAGGTGGACGACCAGCTCCTC
TATGGCACCTTTGCTCTCTTGGCCGAGAGCCGCATGCTGCGCCAGACCGACTTCCAGGACGCCAGCCTGGTGCGC
GAGGCGTCGCAGACGCCCTGCAGCCTGGACCGCTCAGCCGACGAGGTGCGGCCGTTTGGCATGGCGCAGGAAAAC
CGCAAAATGGTGGAGAAGCTGAATTGGCGGGGGGAAAAGTTTCTGGCTGAGCGGCAAACAATTGGCAGAGGCTAT
GCCGGCGACTTGTCGAGGCCCGGGCCCCTGGCCAGCGGGTGTGGGCATATGATGCACTACCACTGCTTCGAGGTC
TACTACGAGGCGACCAACAGCCGGCACACGCACCAGATTGCCCGCCACCACCCCGAGATGATGGCGCTCAACGAG
TTTGTGTGCCCGCTGTGCAAGGCGCGCGGCAACGTCTTCTTGCCCATTATCTGGAAGGGCATGCAAGAGTCGTAC
CCGGGCAGGCTGCAGGCGCGCATGTCGTTTGCCGACTTGCTGGAGCACCAAGTGGCCCTGGACAAGTGGCCGGGC
CAGGGCGCCGAGCCGGGAGCCATGGACGCCATGACGCCTCCGAGGGCCGCGCCGCCGCCGCCCTGGGAACGCCTC
ATGAGCGTGGCGCCCCTCATGATGCCGGCCACTGCTCTTTGCCTGCCCATTGGCCGTGACGGCTCGCGCGGCGTC
GATGGTGCAAACCTCAACATGAACATTATGAATGAGCTCGAGAATGCCTATGCGCGCCTCAAGGAAAGCGTCCGC
CTCAACAAGCTTGACAAGCGATATGACGAGGCCCAGGTGGACGACGGCGCCCAGCTCGACTTGACCGAGATGCTC
GTCTACACCGTGGCCTTTACCCTGTCGTCGGTCGAGTTGCAGCAGCGCGGCGTCGAGGCTCAGCCCGGCATGACG
CTGCTCGAGAGGATACCCGAGCAGACAATTACCCAGCTGAGAGTGCTTGCTGAGACTGCCTCTGCCCTCATCACC
GTCAGGGGCCGCTTCGGCAGCTTTGACAACCTCATGGGCGAGCGCCGCTTCCGCCAGTCGTGCCAGCTCTTCATC
TCACGCCATCTCGCCATGGAGCCGCCCAAGCTGCGCCGTCTGATGAACCTGTATCCGCCCTTGCTGAGTCTGGAC
CCCTTCATCTTCTTGGTCGAGTGCACCTATGGCCTGGGCTCGGTCCAGTCAGTCGACGTGAAGCACCTGCTTAGC
CTGTGCTATCTGGCCGAGCTGGTCAAGGTTGTCTACCACATGAGCCGAAACATGAACATGTCGAAATGGCTCGAG
GCCCTGCAGCAGCGGCAGACCCACGACGAGGCCATCAACAACTTTGCCGACTTTGCCCTTGCCGTGACCGAGTAC
GGCATGTGTGACGACGAGCCGACGCTGCATGCCCAGAGGGCCAATGAGGCCTTTGACCAGCCGGGCGTCGACTCC
CTGCAGGCATGGTACTCGTTTGTCAAGAAGTACGCCCTTGTCTTTTTGCGCAAGAGCCTCTTGCTGCTCTACATC
AAGTACGGCATCGACTTTAACAGCTTTGTCTCCTCCAATGCCGAGGCGGACGAACTGCACCGCCTGACCGAGGCC
ATGATGCTGCCCTCGTTTGACCAAATGTGTGCTAGCTTGACGAGCAAGTCTTTGGCCTGTGGCTGGCCAGAGACA
ATACGAGATGTTGTCCTTGGCTGGGTCAAGCACCAGGTGCTGGGAAGCAACAAGCCAAGCCAAGTACGCCAGACG
GCCATTGTCAGCCACCCAGGCATTTTCGAGCTTATAGGTCTTCCCAAGACGTATGACACCCTCATTGAGGAGGCC
AGTCGCAGAAAGTGTCCCACGACGGGCAAGGACGTCATGGACCCCGCCATCTGTCTATTTTGCGGCGAAATGGTT
TGCAGCCAGAGCACCTGTTGCCAGAAGCTCTGCACAGTGGGCAACGAGTCGGTTAAACTGGGCGGAGGACAGCAA
CACATGCGGCGGTAAGTTGGGTCTCTTTCTTTATCTCTTCACTCATTTCTATGCCCCAAGCCATGTTTTTGAGCC
AGCCGGCTGACTGGGGACTCCCAGGTGCCAACGCAACATTGGCGTCTTCCTCAACATTCGCAAGTGCACCATCAT
TTTCTTCTTTAACCAGTCGGGGTCGTTTGCGGCAGCGCCTTATATGGATCGCTATGGCGAGACGGATTACCAACT
GCGGCACGGGCGACAGCTCTTCCTAAGCCAGAAGAGGTATGACTCGATGATTCGAAACGCCGTCGTGAATAACGA
TGTTCCCGCTTTTGTCAGCCGCCGGCTAGAGCTAGACGTTAACAATGGAGGATGGGACACTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail