Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5471
Gene name
LocationContig_42:103817..105155
Strand+
Gene length (bp)1338
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11711 Tim54 Inner membrane protein import complex subunit Tim54 1.4E-132 29 391

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Q7|TIM54_NEUCR Mitochondrial import inner membrane translocase subunit tim54 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim54 PE=2 SV=2 29 420 2.0E-125
sp|Q2UJY4|TIM54_ASPOR Mitochondrial import inner membrane translocase subunit tim54 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tim54 PE=3 SV=1 37 443 2.0E-96
sp|Q4WQ82|TIM54_ASPFU Mitochondrial import inner membrane translocase subunit tim54 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim54 PE=3 SV=1 50 443 1.0E-85
sp|P48990|TIM54_CANAL Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM54 PE=3 SV=2 21 392 2.0E-48
sp|Q6BTN1|TIM54_DEBHA Mitochondrial import inner membrane translocase subunit TIM54 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM54 PE=3 SV=2 18 393 4.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Q7|TIM54_NEUCR Mitochondrial import inner membrane translocase subunit tim54 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim54 PE=2 SV=2 29 420 2.0E-125
sp|Q2UJY4|TIM54_ASPOR Mitochondrial import inner membrane translocase subunit tim54 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tim54 PE=3 SV=1 37 443 2.0E-96
sp|Q4WQ82|TIM54_ASPFU Mitochondrial import inner membrane translocase subunit tim54 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim54 PE=3 SV=1 50 443 1.0E-85
sp|P48990|TIM54_CANAL Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM54 PE=3 SV=2 21 392 2.0E-48
sp|Q6BTN1|TIM54_DEBHA Mitochondrial import inner membrane translocase subunit TIM54 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM54 PE=3 SV=2 18 393 4.0E-48
sp|Q6FPC0|TIM54_CANGA Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM54 PE=3 SV=1 29 393 1.0E-36
sp|Q758C9|TIM54_ASHGO Mitochondrial import inner membrane translocase subunit TIM54 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM54 PE=3 SV=2 24 370 4.0E-31
sp|O94624|TIM54_SCHPO Mitochondrial import inner membrane translocase subunit tim54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim54 PE=3 SV=1 37 382 3.0E-29
sp|Q6C7Y5|TIM54_YARLI Mitochondrial import inner membrane translocase subunit TIM54 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM54 PE=3 SV=1 12 156 7.0E-29
sp|Q6CLP4|TIM54_KLULA Mitochondrial import inner membrane translocase subunit TIM54 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM54 PE=3 SV=1 42 389 2.0E-27
sp|P47045|TIM54_YEAST Mitochondrial import inner membrane translocase subunit TIM54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM54 PE=1 SV=1 29 170 2.0E-27
sp|P0CR90|TIM54_CRYNJ Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM54 PE=3 SV=1 43 133 1.0E-09
sp|P0CR91|TIM54_CRYNB Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM54 PE=3 SV=1 43 133 1.0E-09
sp|Q6C7Y5|TIM54_YARLI Mitochondrial import inner membrane translocase subunit TIM54 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM54 PE=3 SV=1 217 392 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5471
MASSPPQAQPKPLHAEPKPPLAPKTPSGNPALRMLGLPSLPRKLPSRNWLIFWAVSGALASAIIYDKRQKKRATA
KWRRLVEPLSREPLTAASQLPRKLTIFIEAPPGDGLRAAQDHFIEYVKPVLAASGLDWEFVQGRQQGDVRAAVAE
KVRRLRMPHERPKEKLAQTDEAIVDSLRSKIGVPQYQGVKGDIVIGRHTWKEYVRGLHEGWLGPLDPPPQPDLDD
QAHPSSNATAQDASKTESKHSKEKPPRPSQPPPYNSPDDYDAASLPLYMANELCPSCPISFPHRLGFSQTFVRLA
RFLNRRKLADDIGREVAAACLAAYRPWCEMDGQLEQHLACQDGERDWPKSIWQAKEPATGQTDDPAGPPKDTTWT
SPMVLDTRIASRMRRFHLLPQDEERASGIVVPEDEVEGWIKGSLRSLWRCGAAALGSQPRGPNVGNLDDD*
Coding >OphauB2|5471
ATGGCTTCCTCTCCTCCGCAGGCCCAGCCAAAGCCTCTCCATGCAGAGCCAAAGCCGCCTCTAGCCCCCAAAACC
CCGTCTGGCAATCCCGCTCTGCGCATGCTCGGCCTGCCCAGTCTTCCCCGAAAGCTGCCCTCGCGCAACTGGCTC
ATCTTCTGGGCCGTATCTGGCGCCTTGGCCTCGGCCATTATATACGACAAGCGCCAAAAGAAGCGCGCCACGGCA
AAATGGCGTCGTCTTGTTGAGCCTCTCTCACGAGAGCCCTTGACGGCTGCCAGCCAGCTGCCCCGCAAACTGACC
ATTTTCATCGAGGCGCCTCCCGGCGACGGCCTACGCGCAGCCCAGGACCACTTCATCGAATATGTCAAGCCCGTT
CTCGCCGCTTCTGGTCTTGATTGGGAGTTTGTCCAGGGCCGTCAACAGGGCGACGTGCGTGCGGCCGTTGCCGAA
AAGGTGAGGCGCCTGAGGATGCCTCACGAGCGACCCAAGGAGAAGCTTGCCCAAACCGACGAGGCAATTGTCGAC
AGCTTGAGGAGCAAGATTGGGGTGCCCCAGTACCAAGGTGTCAAGGGTGACATCGTCATTGGCCGCCACACCTGG
AAGGAATATGTTCGAGGCCTACACGAGGGATGGCTTGGGCCCCTGGATCCCCCGCCCCAGCCCGACCTCGACGAC
CAAGCCCACCCAAGCAGCAATGCCACGGCACAAGACGCCTCCAAGACGGAGAGCAAGCACAGCAAGGAGAAGCCC
CCTCGGCCTAGTCAGCCCCCCCCTTACAACTCCCCCGACGACTACGACGCCGCTAGCCTGCCCCTTTACATGGCC
AATGAGCTATGCCCCTCTTGTCCCATTTCCTTTCCTCACCGCCTTGGCTTCTCCCAAACATTTGTGCGCCTCGCC
CGCTTCCTCAATCGCCGCAAGCTTGCCGACGACATTGGGCGCGAGGTGGCCGCCGCTTGTTTGGCAGCATACCGG
CCCTGGTGCGAAATGGACGGCCAGCTGGAACAGCACTTGGCCTGCCAGGATGGAGAGAGGGACTGGCCCAAGAGC
ATATGGCAGGCCAAGGAGCCTGCTACAGGCCAAACCGACGACCCCGCTGGGCCCCCCAAGGACACAACTTGGACA
TCGCCCATGGTGCTCGACACGCGCATTGCCTCTCGTATGCGCCGCTTCCACTTGCTGCCCCAAGACGAGGAGCGC
GCCTCTGGCATTGTCGTGCCCGAAGACGAGGTTGAGGGCTGGATCAAGGGCAGCTTGAGAAGCCTTTGGCGCTGC
GGTGCTGCCGCCCTTGGGAGCCAGCCCAGAGGACCCAATGTGGGCAACTTGGACGACGACTAG
Transcript >OphauB2|5471
ATGGCTTCCTCTCCTCCGCAGGCCCAGCCAAAGCCTCTCCATGCAGAGCCAAAGCCGCCTCTAGCCCCCAAAACC
CCGTCTGGCAATCCCGCTCTGCGCATGCTCGGCCTGCCCAGTCTTCCCCGAAAGCTGCCCTCGCGCAACTGGCTC
ATCTTCTGGGCCGTATCTGGCGCCTTGGCCTCGGCCATTATATACGACAAGCGCCAAAAGAAGCGCGCCACGGCA
AAATGGCGTCGTCTTGTTGAGCCTCTCTCACGAGAGCCCTTGACGGCTGCCAGCCAGCTGCCCCGCAAACTGACC
ATTTTCATCGAGGCGCCTCCCGGCGACGGCCTACGCGCAGCCCAGGACCACTTCATCGAATATGTCAAGCCCGTT
CTCGCCGCTTCTGGTCTTGATTGGGAGTTTGTCCAGGGCCGTCAACAGGGCGACGTGCGTGCGGCCGTTGCCGAA
AAGGTGAGGCGCCTGAGGATGCCTCACGAGCGACCCAAGGAGAAGCTTGCCCAAACCGACGAGGCAATTGTCGAC
AGCTTGAGGAGCAAGATTGGGGTGCCCCAGTACCAAGGTGTCAAGGGTGACATCGTCATTGGCCGCCACACCTGG
AAGGAATATGTTCGAGGCCTACACGAGGGATGGCTTGGGCCCCTGGATCCCCCGCCCCAGCCCGACCTCGACGAC
CAAGCCCACCCAAGCAGCAATGCCACGGCACAAGACGCCTCCAAGACGGAGAGCAAGCACAGCAAGGAGAAGCCC
CCTCGGCCTAGTCAGCCCCCCCCTTACAACTCCCCCGACGACTACGACGCCGCTAGCCTGCCCCTTTACATGGCC
AATGAGCTATGCCCCTCTTGTCCCATTTCCTTTCCTCACCGCCTTGGCTTCTCCCAAACATTTGTGCGCCTCGCC
CGCTTCCTCAATCGCCGCAAGCTTGCCGACGACATTGGGCGCGAGGTGGCCGCCGCTTGTTTGGCAGCATACCGG
CCCTGGTGCGAAATGGACGGCCAGCTGGAACAGCACTTGGCCTGCCAGGATGGAGAGAGGGACTGGCCCAAGAGC
ATATGGCAGGCCAAGGAGCCTGCTACAGGCCAAACCGACGACCCCGCTGGGCCCCCCAAGGACACAACTTGGACA
TCGCCCATGGTGCTCGACACGCGCATTGCCTCTCGTATGCGCCGCTTCCACTTGCTGCCCCAAGACGAGGAGCGC
GCCTCTGGCATTGTCGTGCCCGAAGACGAGGTTGAGGGCTGGATCAAGGGCAGCTTGAGAAGCCTTTGGCGCTGC
GGTGCTGCCGCCCTTGGGAGCCAGCCCAGAGGACCCAATGTGGGCAACTTGGACGACGACTAG
Gene >OphauB2|5471
ATGGCTTCCTCTCCTCCGCAGGCCCAGCCAAAGCCTCTCCATGCAGAGCCAAAGCCGCCTCTAGCCCCCAAAACC
CCGTCTGGCAATCCCGCTCTGCGCATGCTCGGCCTGCCCAGTCTTCCCCGAAAGCTGCCCTCGCGCAACTGGCTC
ATCTTCTGGGCCGTATCTGGCGCCTTGGCCTCGGCCATTATATACGACAAGCGCCAAAAGAAGCGCGCCACGGCA
AAATGGCGTCGTCTTGTTGAGCCTCTCTCACGAGAGCCCTTGACGGCTGCCAGCCAGCTGCCCCGCAAACTGACC
ATTTTCATCGAGGCGCCTCCCGGCGACGGCCTACGCGCAGCCCAGGACCACTTCATCGAATATGTCAAGCCCGTT
CTCGCCGCTTCTGGTCTTGATTGGGAGTTTGTCCAGGGCCGTCAACAGGGCGACGTGCGTGCGGCCGTTGCCGAA
AAGGTGAGGCGCCTGAGGATGCCTCACGAGCGACCCAAGGAGAAGCTTGCCCAAACCGACGAGGCAATTGTCGAC
AGCTTGAGGAGCAAGATTGGGGTGCCCCAGTACCAAGGTGTCAAGGGTGACATCGTCATTGGCCGCCACACCTGG
AAGGAATATGTTCGAGGCCTACACGAGGGATGGCTTGGGCCCCTGGATCCCCCGCCCCAGCCCGACCTCGACGAC
CAAGCCCACCCAAGCAGCAATGCCACGGCACAAGACGCCTCCAAGACGGAGAGCAAGCACAGCAAGGAGAAGCCC
CCTCGGCCTAGTCAGCCCCCCCCTTACAACTCCCCCGACGACTACGACGCCGCTAGCCTGCCCCTTTACATGGCC
AATGAGCTATGCCCCTCTTGTCCCATTTCCTTTCCTCACCGCCTTGGCTTCTCCCAAACATTTGTGCGCCTCGCC
CGCTTCCTCAATCGCCGCAAGCTTGCCGACGACATTGGGCGCGAGGTGGCCGCCGCTTGTTTGGCAGCATACCGG
CCCTGGTGCGAAATGGACGGCCAGCTGGAACAGCACTTGGCCTGCCAGGATGGAGAGAGGGACTGGCCCAAGAGC
ATATGGCAGGCCAAGGAGCCTGCTACAGGCCAAACCGACGACCCCGCTGGGCCCCCCAAGGACACAACTTGGACA
TCGCCCATGGTGCTCGACACGCGCATTGCCTCTCGTATGCGCCGCTTCCACTTGCTGCCCCAAGACGAGGAGCGC
GCCTCTGGCATTGTCGTGCCCGAAGACGAGGTTGAGGGCTGGATCAAGGGCAGCTTGAGAAGCCTTTGGCGCTGC
GGTGCTGCCGCCCTTGGGAGCCAGCCCAGAGGACCCAATGTGGGCAACTTGGACGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail