Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5467
Gene name
LocationContig_42:95553..97256
Strand-
Gene length (bp)1703
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 5.1E-12 310 403
PF08701 GN3L_Grn1 GNL3L/Grn1 putative GTPase 5.7E-11 19 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 9 535 1.0E-129
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 10 531 1.0E-117
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 187 534 3.0E-53
sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=Ns1 PE=1 SV=2 5 534 2.0E-48
sp|Q54KS4|GNL3_DICDI Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum GN=gnl3 PE=3 SV=1 181 523 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 9 535 1.0E-129
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 10 531 1.0E-117
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 187 534 3.0E-53
sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=Ns1 PE=1 SV=2 5 534 2.0E-48
sp|Q54KS4|GNL3_DICDI Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum GN=gnl3 PE=3 SV=1 181 523 2.0E-47
sp|Q9M8Z5|NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana GN=NSN1 PE=2 SV=1 185 535 2.0E-45
sp|Q9NVN8|GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens GN=GNL3L PE=1 SV=1 185 499 1.0E-42
sp|Q3T0J9|GNL3L_BOVIN Guanine nucleotide-binding protein-like 3-like protein OS=Bos taurus GN=GNL3L PE=2 SV=1 185 499 6.0E-42
sp|Q6PGG6|GNL3L_MOUSE Guanine nucleotide-binding protein-like 3-like protein OS=Mus musculus GN=Gnl3l PE=1 SV=1 185 532 8.0E-42
sp|Q10LF7|NUG2_ORYSJ Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. japonica GN=NUG2 PE=1 SV=1 154 496 2.0E-39
sp|A2XGQ1|NUG2_ORYSI Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. indica GN=NUG2 PE=3 SV=1 154 496 2.0E-39
sp|Q9C923|NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana GN=NUG2 PE=1 SV=1 185 498 3.0E-39
sp|Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens GN=GNL3 PE=1 SV=2 5 497 5.0E-39
sp|Q99LH1|NOG2_MOUSE Nucleolar GTP-binding protein 2 OS=Mus musculus GN=Gnl2 PE=1 SV=2 139 504 5.0E-37
sp|Q7SHR8|NOG2_NEUCR Nucleolar GTP-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nog-2 PE=3 SV=1 163 520 8.0E-37
sp|Q75DA4|NOG2_ASHGO Nucleolar GTP-binding protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOG2 PE=3 SV=1 164 496 2.0E-36
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens GN=GNL2 PE=1 SV=1 139 496 4.0E-36
sp|O14236|NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog2 PE=1 SV=1 166 525 5.0E-36
sp|Q6C036|NOG2_YARLI Nucleolar GTP-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOG2 PE=3 SV=1 169 515 4.0E-35
sp|Q6FWS1|NOG2_CANGA Nucleolar GTP-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOG2 PE=3 SV=1 165 496 1.0E-34
sp|Q6CSP9|NOG2_KLULA Nucleolar GTP-binding protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOG2 PE=3 SV=1 166 496 2.0E-34
sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 185 496 2.0E-33
sp|P53742|NOG2_YEAST Nucleolar GTP-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOG2 PE=1 SV=1 165 493 3.0E-33
sp|Q8CI11|GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus GN=Gnl3 PE=1 SV=2 180 496 4.0E-33
sp|Q6P4W5|GNL3_XENTR Guanine nucleotide-binding protein-like 3 OS=Xenopus tropicalis GN=gnl3 PE=2 SV=2 195 499 6.0E-33
sp|P0CS94|NOG2_CRYNV Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii GN=NOG2 PE=3 SV=1 155 532 1.0E-30
sp|J9VQ03|NOG2_CRYNH Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=NOG2 PE=3 SV=2 171 532 1.0E-30
sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2 OS=Pneumocystis carinii GN=NOG2 PE=2 SV=1 158 495 2.0E-30
sp|Q811S9|GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus GN=Gnl3 PE=1 SV=1 180 496 6.0E-30
sp|Q6TGJ8|NOG2_CRYGA Nucleolar GTP-binding protein 2 OS=Cryptococcus gattii GN=NOG2 PE=3 SV=1 171 496 2.0E-28
sp|Q7ZX41|GNL3_XENLA Guanine nucleotide-binding protein-like 3 OS=Xenopus laevis GN=gnl3 PE=2 SV=1 195 500 6.0E-28
sp|Q9SHS8|LSG11_ARATH GTPase LSG1-1 OS=Arabidopsis thaliana GN=LSG1-1 PE=1 SV=1 195 498 7.0E-20
sp|Q58859|Y1464_METJA Uncharacterized GTP-binding protein MJ1464 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1464 PE=3 SV=1 191 492 9.0E-20
sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 195 499 7.0E-18
sp|Q9W590|LSG1_DROME Large subunit GTPase 1 homolog OS=Drosophila melanogaster GN=Ns3 PE=1 SV=1 298 499 3.0E-17
sp|Q9SJF1|LSG12_ARATH GTPase LSG1-2 OS=Arabidopsis thaliana GN=LSG1-2 PE=1 SV=1 195 499 8.0E-17
sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 191 496 2.0E-16
sp|Q8H1F6|DGP3_ARATH DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana GN=DGP3 PE=2 SV=1 190 500 3.0E-16
sp|Q29AU5|MTG1_DROPS Mitochondrial GTPase 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14342 PE=3 SV=2 193 378 2.0E-14
sp|Q9VCU5|MTG1_DROME Mitochondrial ribosome-associated GTPase 1 OS=Drosophila melanogaster GN=CG17141 PE=1 SV=2 193 376 3.0E-12
sp|Q9WZM6|RBGA_THEMA Ribosome biogenesis GTPase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbgA PE=1 SV=1 194 488 4.0E-12
sp|Q6NY89|LSG1_DANRE Large subunit GTPase 1 homolog OS=Danio rerio GN=lsg1 PE=2 SV=1 270 498 6.0E-12
sp|Q5RA07|GNL1_PONAB Guanine nucleotide-binding protein-like 1 OS=Pongo abelii GN=GNL1 PE=2 SV=1 187 496 2.0E-11
sp|Q5TM59|GNL1_MACMU Guanine nucleotide-binding protein-like 1 OS=Macaca mulatta GN=GNL1 PE=3 SV=1 187 496 2.0E-11
sp|Q4R8D2|GNL1_MACFA Guanine nucleotide-binding protein-like 1 OS=Macaca fascicularis GN=GNL1 PE=2 SV=1 187 496 2.0E-11
sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens GN=LSG1 PE=1 SV=2 278 496 3.0E-11
sp|Q7YR35|GNL1_PANTR Guanine nucleotide-binding protein-like 1 OS=Pan troglodytes GN=GNL1 PE=3 SV=3 187 496 3.0E-11
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 191 489 4.0E-11
sp|Q5ZJD3|LSG1_CHICK Large subunit GTPase 1 homolog OS=Gallus gallus GN=LSG1 PE=2 SV=1 273 498 1.0E-10
sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus GN=LSG1 PE=2 SV=1 291 496 1.0E-10
sp|A8FD69|RBGA_BACP2 Ribosome biogenesis GTPase A OS=Bacillus pumilus (strain SAFR-032) GN=rbgA PE=3 SV=1 201 485 3.0E-10
sp|Q3UM18|LSG1_MOUSE Large subunit GTPase 1 homolog OS=Mus musculus GN=Lsg1 PE=1 SV=2 271 496 3.0E-10
sp|D5DJL5|RBGA_BACMD Ribosome biogenesis GTPase A OS=Bacillus megaterium (strain DSM 319) GN=rbgA PE=3 SV=1 191 375 4.0E-10
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 187 509 5.0E-10
sp|Q5BJT6|LSG1_RAT Large subunit GTPase 1 homolog OS=Rattus norvegicus GN=Lsg1 PE=2 SV=1 273 496 6.0E-10
sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 OS=Homo sapiens GN=GNL1 PE=1 SV=2 187 496 9.0E-10
sp|B7GGD6|RBGA_ANOFW Ribosome biogenesis GTPase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rbgA PE=3 SV=1 201 489 1.0E-09
sp|Q4R8L2|LSG1_MACFA Large subunit GTPase 1 homolog OS=Macaca fascicularis GN=LSG1 PE=2 SV=1 278 496 1.0E-09
sp|C5D8U8|RBGA_GEOSW Ribosome biogenesis GTPase A OS=Geobacillus sp. (strain WCH70) GN=rbgA PE=3 SV=1 201 375 1.0E-08
sp|Q65JP4|RBGA_BACLD Ribosome biogenesis GTPase A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbgA PE=3 SV=1 201 485 2.0E-08
sp|O31743|RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) GN=rbgA PE=1 SV=1 201 498 4.0E-08
sp|E0TTS5|RBGA_BACPZ Ribosome biogenesis GTPase A OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=rbgA PE=3 SV=1 201 498 4.0E-08
sp|Q819W8|RBGA_BACCR Ribosome biogenesis GTPase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbgA PE=3 SV=1 194 391 4.0E-07
sp|Q8L607|SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana GN=SIN2 PE=1 SV=1 200 376 5.0E-07
sp|Q8SUT1|GNL3L_ENCCU Guanine nucleotide-binding protein-like 3-like protein OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0330 PE=1 SV=2 195 327 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5467
MAGTINKPKKPKSKRGTSRLRHKIEKKAAAKQRKQRKLAKNNPEWRSKLKKDPGVLSTFAHRMMESKDGSLEPRR
IALARQLAKRAQSGPDQAGHDAHGSAEQDDDQEDKGLGADTDESHHGSDNDVDMDDDVDESNPMAALLASAKSAA
ARYNGRFDSDHDMADDDDDASCCQAEASVSGSSMSRKTYDKVFKQVVEQADVVLYVLDARDPEGTRSREVERSVM
AAASGGKRLMLIVNKMDLVPPKVLRGWLLHLRRYFPSLPLRAAGAAANATTFNHGDLTAANTAASLFGALKTFAA
TRQLKRAVSVGVIGYPNVGKSSVINALLSRMSGKGRGAKVKPCPAGAEAGVTRSIRSVKIDSKLTLLDSPGVVFP
SSSSLPGSLVALDNAIDAHAHLVLLNAVPPKQIDDAMPAVSLLIRRLSLSPDLMHKLTDFYDIAPLLPDAGDGDV
TTDFLVQVARKRGRLGRGGVPNVNAAAMTVVTDWRDGRIQGWVEPPTLPLESDLVATNKGEGGIMADQKEIVSEW
AAEFKLEGLWGDDEAGKNN*
Coding >OphauB2|5467
ATGGCTGGCACGATCAACAAACCAAAAAAGCCCAAGTCGAAGCGCGGCACCAGTCGGCTTCGCCACAAGATTGAG
AAGAAGGCAGCAGCCAAGCAGAGGAAACAACGCAAATTGGCGAAAAACAACCCCGAGTGGAGGTCCAAGTTGAAG
AAGGATCCGGGCGTCTTGTCGACGTTTGCCCATAGAATGATGGAGTCAAAGGATGGAAGCTTGGAACCGCGCAGA
ATAGCACTGGCCCGGCAGCTGGCCAAGAGGGCTCAGTCGGGCCCCGATCAGGCTGGCCATGACGCACACGGCTCA
GCAGAGCAAGACGACGACCAAGAGGACAAGGGATTGGGCGCCGACACTGACGAGAGCCATCATGGCAGCGACAAT
GACGTGGACATGGACGACGACGTGGATGAGTCTAATCCCATGGCTGCGCTGCTGGCCAGTGCCAAGAGTGCAGCA
GCACGGTATAATGGCCGATTTGATAGCGACCATGACATGGCAGATGACGACGACGACGCCTCTTGTTGCCAGGCT
GAAGCTAGCGTCTCTGGGTCGAGCATGTCGCGCAAAACCTACGACAAGGTATTCAAGCAAGTCGTGGAGCAGGCC
GACGTGGTTCTCTACGTGCTCGACGCGCGCGACCCCGAAGGCACTCGCAGCCGCGAGGTGGAGCGCAGCGTCATG
GCGGCAGCATCGGGTGGCAAGCGCCTCATGCTTATTGTCAACAAGATGGACCTGGTGCCGCCAAAGGTGCTACGC
GGCTGGCTCCTTCATCTGCGCCGCTATTTCCCTAGCCTGCCGCTGCGGGCAGCAGGCGCTGCCGCCAATGCCACC
ACTTTTAACCATGGCGATTTGACGGCGGCAAACACGGCCGCGTCGCTCTTTGGCGCACTCAAAACCTTTGCTGCA
ACAAGACAGCTCAAGCGCGCCGTGTCGGTGGGCGTCATTGGATACCCCAATGTGGGCAAAAGCTCCGTCATCAAT
GCCCTGCTTAGTAGGATGAGCGGCAAGGGCCGAGGCGCAAAGGTCAAGCCGTGTCCTGCCGGCGCCGAGGCGGGC
GTCACAAGGAGCATTCGCTCCGTCAAGATTGACAGCAAGCTCACTCTGCTTGATTCGCCCGGCGTCGTCTTCCCC
TCGTCGTCGTCGTTGCCTGGAAGCCTTGTTGCCCTTGACAATGCCATTGACGCCCATGCTCACCTTGTCCTCCTC
AATGCCGTGCCGCCCAAGCAGATTGACGACGCCATGCCCGCCGTCAGCCTCCTTATTCGCCGGCTGTCCCTCTCG
CCTGATTTGATGCACAAACTGACCGACTTTTACGACATTGCCCCGTTGCTGCCAGACGCTGGCGACGGTGACGTG
ACGACTGACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGCGGCGTGCCCAATGTGAATGCG
GCCGCCATGACGGTCGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTCGAGCCTCCCACTCTTCCCTTG
GAGTCGGACCTCGTTGCCACAAACAAGGGCGAGGGAGGCATCATGGCGGATCAAAAGGAAATAGTCTCTGAGTGG
GCAGCCGAGTTTAAGCTCGAGGGCCTCTGGGGCGACGACGAGGCTGGCAAGAATAATTAA
Transcript >OphauB2|5467
ATGGCTGGCACGATCAACAAACCAAAAAAGCCCAAGTCGAAGCGCGGCACCAGTCGGCTTCGCCACAAGATTGAG
AAGAAGGCAGCAGCCAAGCAGAGGAAACAACGCAAATTGGCGAAAAACAACCCCGAGTGGAGGTCCAAGTTGAAG
AAGGATCCGGGCGTCTTGTCGACGTTTGCCCATAGAATGATGGAGTCAAAGGATGGAAGCTTGGAACCGCGCAGA
ATAGCACTGGCCCGGCAGCTGGCCAAGAGGGCTCAGTCGGGCCCCGATCAGGCTGGCCATGACGCACACGGCTCA
GCAGAGCAAGACGACGACCAAGAGGACAAGGGATTGGGCGCCGACACTGACGAGAGCCATCATGGCAGCGACAAT
GACGTGGACATGGACGACGACGTGGATGAGTCTAATCCCATGGCTGCGCTGCTGGCCAGTGCCAAGAGTGCAGCA
GCACGGTATAATGGCCGATTTGATAGCGACCATGACATGGCAGATGACGACGACGACGCCTCTTGTTGCCAGGCT
GAAGCTAGCGTCTCTGGGTCGAGCATGTCGCGCAAAACCTACGACAAGGTATTCAAGCAAGTCGTGGAGCAGGCC
GACGTGGTTCTCTACGTGCTCGACGCGCGCGACCCCGAAGGCACTCGCAGCCGCGAGGTGGAGCGCAGCGTCATG
GCGGCAGCATCGGGTGGCAAGCGCCTCATGCTTATTGTCAACAAGATGGACCTGGTGCCGCCAAAGGTGCTACGC
GGCTGGCTCCTTCATCTGCGCCGCTATTTCCCTAGCCTGCCGCTGCGGGCAGCAGGCGCTGCCGCCAATGCCACC
ACTTTTAACCATGGCGATTTGACGGCGGCAAACACGGCCGCGTCGCTCTTTGGCGCACTCAAAACCTTTGCTGCA
ACAAGACAGCTCAAGCGCGCCGTGTCGGTGGGCGTCATTGGATACCCCAATGTGGGCAAAAGCTCCGTCATCAAT
GCCCTGCTTAGTAGGATGAGCGGCAAGGGCCGAGGCGCAAAGGTCAAGCCGTGTCCTGCCGGCGCCGAGGCGGGC
GTCACAAGGAGCATTCGCTCCGTCAAGATTGACAGCAAGCTCACTCTGCTTGATTCGCCCGGCGTCGTCTTCCCC
TCGTCGTCGTCGTTGCCTGGAAGCCTTGTTGCCCTTGACAATGCCATTGACGCCCATGCTCACCTTGTCCTCCTC
AATGCCGTGCCGCCCAAGCAGATTGACGACGCCATGCCCGCCGTCAGCCTCCTTATTCGCCGGCTGTCCCTCTCG
CCTGATTTGATGCACAAACTGACCGACTTTTACGACATTGCCCCGTTGCTGCCAGACGCTGGCGACGGTGACGTG
ACGACTGACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGCGGCGTGCCCAATGTGAATGCG
GCCGCCATGACGGTCGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTCGAGCCTCCCACTCTTCCCTTG
GAGTCGGACCTCGTTGCCACAAACAAGGGCGAGGGAGGCATCATGGCGGATCAAAAGGAAATAGTCTCTGAGTGG
GCAGCCGAGTTTAAGCTCGAGGGCCTCTGGGGCGACGACGAGGCTGGCAAGAATAATTAA
Gene >OphauB2|5467
ATGGCTGGCACGATCAACAAACCAAAAAGTATGCTTCTGCACGTCATTGTAAAGGCAAGCAGCGTGCCTGACTGA
CTCTTGTCGTGTGACGCGCAGAGCCCAAGTCGAAGCGCGGCACCAGTCGGCTTCGCCACAAGATTGAGAAGAAGG
CAGCAGCCAAGCAGAGGAAACAACGCAAATTGGCGAAAAACAACCCCGAGTGGAGGTCCAAGTTGAAGAAGGATC
CGGGCGTCTTGTCGACGTTTGCCCATAGAATGATGGAGTCAAAGGATGGAAGCTTGGAACCGCGCAGAATAGCAC
TGGCCCGGCAGCTGGCCAAGAGGGCTCAGTCGGGCCCCGATCAGGCTGGCCATGACGCACACGGCTCAGCAGAGC
AAGACGACGACCAAGAGGACAAGGGATTGGGCGCCGACACTGACGAGAGCCATCATGGCAGCGACAATGACGTGG
ACATGGACGACGACGTGGATGAGTCTAATCCCATGGCTGCGCTGCTGGCCAGTGCCAAGAGTGCAGCAGCACGGT
ATAATGGCCGATTTGATAGCGACCATGACATGGCAGATGACGACGACGACGCCTCTTGTTGCCAGGCTGAAGCTA
GCGTCTCTGGGTCGAGCATGTCGCGCAAAACCTACGACAAGGTATTCAAGCAAGTCGTGGAGCAGGCCGACGTGG
TTCTCTACGTGCTCGACGCGCGCGACCCCGAAGGCACTCGCAGCCGCGAGGTGGAGCGCAGCGTCATGGCGGCAG
CATCGGGTGGCAAGCGCCTCATGCTTATTGTCAACAAGATGGACCTGGTGCCGCCAAAGGTGCTACGCGGCTGGC
TCCTTCATCTGCGCCGCTATTTCCCTAGCCTGCCGCTGCGGGCAGCAGGCGCTGCCGCCAATGCCACCACTTTTA
ACCATGGCGATTTGACGGCGGCAAACACGGCCGCGTCGCTCTTTGGCGCACTCAAAACCTTTGCTGCAACAAGAC
AGCTCAAGCGCGCCGTGTCGGTGGGCGTCATTGGATACCCCAATGTGGGCAAAAGCTCCGTCATCAATGCCCTGC
TTAGTAGGATGAGCGGCAAGGGCCGAGGCGCAAAGGTCAAGCCGTGTCCTGCCGGCGCCGAGGCGGGCGTCACAA
GGAGCATTCGCTCCGTCAAGATTGACAGCAAGCTCACTCTGCTTGATTCGCCCGGCGTCGTCTTCCCCTCGTCGT
CGTCGTTGCCTGGAAGCCTTGTTGCCCTTGACAATGCCATTGACGCCCATGCTCACCTTGTCCTCCTCAATGCCG
TGCCGCCCAAGCAGATTGACGACGCCATGCCCGCCGTCAGCCTCCTTATTCGCCGGCTGTCCCTCTCGCCTGATT
TGATGCACAAACTGACCGACTTTTACGACATTGCCCCGTTGCTGCCAGACGCTGGCGACGGTGACGTGACGACTG
ACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGCGGCGTGCCCAATGTGAATGCGGCCGCCA
TGACGGTCGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTCGAGCCTCCCACTCTTCCCTTGGAGTCGG
ACCTCGTTGCCACAAACAAGGGCGAGGGAGGCATCATGGCGGATCAAAAGGAAATAGTCTCTGAGTGGGCAGCCG
AGTTTAAGCTCGAGGGCCTCTGGGGCGACGACGAGGCTGGCAAGAATAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail