Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|546
Gene name
LocationContig_11:49815..50319
Strand-
Gene length (bp)504
Transcript length (bp)504
Coding sequence length (bp)504
Protein length (aa) 168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.610896

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4587
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3198
Ophiocordyceps australis map64 (Brazil) OphauB2|546 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06296
Ophiocordyceps camponoti-rufipedis Ophun1|2620
Ophiocordyceps kimflemingae Ophio5|7307
Ophiocordyceps subramaniannii Hirsu2|963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|546
MLWPTLLLGFTASASAAVNFMAAMPHARSAALAPRQTDSQDATQSMPPSECLSAAQDVLTTFPTPPAEIQSELIK
LPQSDPCSFSTPASLSSQFAQFSSDVVEWMSMNQNKLSACPALASFNSIATCNKAKDGSDAADATETANAGPRET
GMAMAALAAAGFAVLAL*
Coding >OphauB2|546
ATGCTCTGGCCAACTCTGCTCCTCGGCTTCACCGCCTCAGCCTCTGCCGCCGTCAACTTCATGGCCGCCATGCCT
CACGCCCGCTCAGCTGCCCTTGCTCCTCGCCAAACAGACTCCCAAGATGCCACACAGTCCATGCCGCCCTCGGAA
TGCCTCTCGGCCGCTCAAGATGTCCTCACCACCTTCCCTACGCCCCCGGCCGAAATCCAGTCGGAGCTCATCAAA
CTCCCCCAGTCAGACCCGTGCAGCTTCAGCACCCCAGCTAGCCTCAGCAGCCAGTTTGCCCAGTTCTCTTCAGAT
GTCGTTGAATGGATGTCGATGAATCAGAACAAGCTCAGTGCTTGCCCCGCCCTCGCCAGCTTCAATTCTATTGCT
ACTTGCAACAAGGCCAAGGATGGAAGCGATGCCGCTGATGCTACCGAAACCGCCAACGCCGGCCCTCGTGAGACG
GGAATGGCCATGGCCGCTCTGGCTGCCGCTGGCTTTGCTGTCTTGGCCCTGTAA
Transcript >OphauB2|546
ATGCTCTGGCCAACTCTGCTCCTCGGCTTCACCGCCTCAGCCTCTGCCGCCGTCAACTTCATGGCCGCCATGCCT
CACGCCCGCTCAGCTGCCCTTGCTCCTCGCCAAACAGACTCCCAAGATGCCACACAGTCCATGCCGCCCTCGGAA
TGCCTCTCGGCCGCTCAAGATGTCCTCACCACCTTCCCTACGCCCCCGGCCGAAATCCAGTCGGAGCTCATCAAA
CTCCCCCAGTCAGACCCGTGCAGCTTCAGCACCCCAGCTAGCCTCAGCAGCCAGTTTGCCCAGTTCTCTTCAGAT
GTCGTTGAATGGATGTCGATGAATCAGAACAAGCTCAGTGCTTGCCCCGCCCTCGCCAGCTTCAATTCTATTGCT
ACTTGCAACAAGGCCAAGGATGGAAGCGATGCCGCTGATGCTACCGAAACCGCCAACGCCGGCCCTCGTGAGACG
GGAATGGCCATGGCCGCTCTGGCTGCCGCTGGCTTTGCTGTCTTGGCCCTGTAA
Gene >OphauB2|546
ATGCTCTGGCCAACTCTGCTCCTCGGCTTCACCGCCTCAGCCTCTGCCGCCGTCAACTTCATGGCCGCCATGCCT
CACGCCCGCTCAGCTGCCCTTGCTCCTCGCCAAACAGACTCCCAAGATGCCACACAGTCCATGCCGCCCTCGGAA
TGCCTCTCGGCCGCTCAAGATGTCCTCACCACCTTCCCTACGCCCCCGGCCGAAATCCAGTCGGAGCTCATCAAA
CTCCCCCAGTCAGACCCGTGCAGCTTCAGCACCCCAGCTAGCCTCAGCAGCCAGTTTGCCCAGTTCTCTTCAGAT
GTCGTTGAATGGATGTCGATGAATCAGAACAAGCTCAGTGCTTGCCCCGCCCTCGCCAGCTTCAATTCTATTGCT
ACTTGCAACAAGGCCAAGGATGGAAGCGATGCCGCTGATGCTACCGAAACCGCCAACGCCGGCCCTCGTGAGACG
GGAATGGCCATGGCCGCTCTGGCTGCCGCTGGCTTTGCTGTCTTGGCCCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail