Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5456
Gene name
LocationContig_42:61380..62402
Strand+
Gene length (bp)1022
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 6.0E-42 35 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG1|RPF2_SCHPO Ribosome production factor 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.08c PE=1 SV=1 1 299 2.0E-96
sp|P36160|RPF2_YEAST Ribosome biogenesis protein RPF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF2 PE=1 SV=1 1 313 6.0E-95
sp|Q9JJ80|RPF2_MOUSE Ribosome production factor 2 homolog OS=Mus musculus GN=Rpf2 PE=2 SV=2 5 318 2.0E-70
sp|Q9H7B2|RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens GN=RPF2 PE=1 SV=2 3 318 1.0E-68
sp|Q2YDN6|RPF2_BOVIN Ribosome production factor 2 homolog OS=Bos taurus GN=RPF2 PE=2 SV=1 3 317 3.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG1|RPF2_SCHPO Ribosome production factor 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.08c PE=1 SV=1 1 299 2.0E-96
sp|P36160|RPF2_YEAST Ribosome biogenesis protein RPF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF2 PE=1 SV=1 1 313 6.0E-95
sp|Q9JJ80|RPF2_MOUSE Ribosome production factor 2 homolog OS=Mus musculus GN=Rpf2 PE=2 SV=2 5 318 2.0E-70
sp|Q9H7B2|RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens GN=RPF2 PE=1 SV=2 3 318 1.0E-68
sp|Q2YDN6|RPF2_BOVIN Ribosome production factor 2 homolog OS=Bos taurus GN=RPF2 PE=2 SV=1 3 317 3.0E-68
sp|Q9VEB3|RPF2_DROME Ribosome production factor 2 homolog OS=Drosophila melanogaster GN=Non3 PE=2 SV=3 1 298 4.0E-59
sp|Q9N3F0|RPF2_CAEEL Ribosome production factor 2 homolog OS=Caenorhabditis elegans GN=Y54E10A.10 PE=3 SV=1 1 298 1.0E-54
sp|Q54DJ0|RPF2_DICDI Ribosome production factor 2 homolog OS=Dictyostelium discoideum GN=bxdc1 PE=3 SV=1 12 296 8.0E-49
sp|Q9AWM9|RPF2_ORYSJ Ribosome production factor 2 homolog OS=Oryza sativa subsp. japonica GN=Os01g0513800 PE=2 SV=1 7 297 2.0E-47
sp|Q9LUG5|RPF2_ARATH Ribosome production factor 2 homolog OS=Arabidopsis thaliana GN=At3g23620 PE=2 SV=1 1 301 3.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0006364 rRNA processing Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5456
MLRQVKPRNARSKRALEKREPKTVENPKTCLFLRGTSCSQIVQDALNELYSLRQPFAKKFSKKNAIHPFEDASSL
EFFAEKNDTSLLVFGSSQKKRPHALTFARTFGNRLLDMLELYLDPQSFRCMAQFKTKKVAIGLRPMILFAGTPFE
SPVSNEYTLAKSLLLDFFKGDVSSGQIDVEGLQYIISISSEQEIASDGDIKPPIRIRAYLIRTLRSGQKLPRVEL
EEMGPRMDLRVGRVREPDQSMLKEAMRKARGTEEKTKKNISTDTMGDKLGRVHLGRQDLGQLQTRKMKGLKRSIH
DEPHDNVDSDAKNAKKSKTMS*
Coding >OphauB2|5456
ATGCTTCGCCAAGTCAAACCCCGCAACGCTCGCTCGAAGCGGGCTCTCGAGAAGCGCGAGCCCAAAACCGTCGAG
AACCCCAAGACATGCCTCTTCCTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTCTAC
TCGCTCCGACAGCCCTTCGCCAAGAAATTCTCAAAGAAAAATGCCATTCACCCGTTCGAAGACGCCTCATCATTA
GAATTCTTTGCTGAAAAGAACGATACCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGTCCACATGCCCTC
ACCTTTGCCCGTACCTTTGGAAACCGTCTGCTCGACATGCTTGAACTCTACCTTGACCCACAATCTTTTCGTTGC
ATGGCCCAATTCAAGACCAAAAAGGTTGCCATCGGTTTGCGACCAATGATTCTCTTTGCCGGTACCCCTTTTGAG
AGCCCCGTGAGCAATGAATACACCTTGGCAAAGAGCCTACTTTTAGACTTTTTCAAAGGTGATGTCTCCTCGGGC
CAGATTGATGTGGAAGGCTTGCAATACATCATCTCTATTTCAAGCGAGCAAGAGATTGCTTCCGATGGCGATATC
AAGCCTCCCATTCGGATCCGCGCCTACCTCATTCGCACTCTACGCAGTGGTCAGAAGCTTCCTCGCGTCGAGCTT
GAAGAAATGGGTCCTCGCATGGATCTACGGGTTGGTCGTGTCAGAGAACCCGACCAATCCATGCTCAAGGAGGCT
ATGCGCAAGGCCCGTGGCACCGAGGAAAAGACCAAGAAGAACATTTCAACCGATACCATGGGTGACAAGCTCGGC
CGTGTACATTTGGGAAGGCAGGACCTAGGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACAT
GACGAGCCTCACGACAATGTCGATTCTGATGCAAAAAATGCAAAAAAATCCAAAACTATGTCATGA
Transcript >OphauB2|5456
ATGCTTCGCCAAGTCAAACCCCGCAACGCTCGCTCGAAGCGGGCTCTCGAGAAGCGCGAGCCCAAAACCGTCGAG
AACCCCAAGACATGCCTCTTCCTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTCTAC
TCGCTCCGACAGCCCTTCGCCAAGAAATTCTCAAAGAAAAATGCCATTCACCCGTTCGAAGACGCCTCATCATTA
GAATTCTTTGCTGAAAAGAACGATACCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGTCCACATGCCCTC
ACCTTTGCCCGTACCTTTGGAAACCGTCTGCTCGACATGCTTGAACTCTACCTTGACCCACAATCTTTTCGTTGC
ATGGCCCAATTCAAGACCAAAAAGGTTGCCATCGGTTTGCGACCAATGATTCTCTTTGCCGGTACCCCTTTTGAG
AGCCCCGTGAGCAATGAATACACCTTGGCAAAGAGCCTACTTTTAGACTTTTTCAAAGGTGATGTCTCCTCGGGC
CAGATTGATGTGGAAGGCTTGCAATACATCATCTCTATTTCAAGCGAGCAAGAGATTGCTTCCGATGGCGATATC
AAGCCTCCCATTCGGATCCGCGCCTACCTCATTCGCACTCTACGCAGTGGTCAGAAGCTTCCTCGCGTCGAGCTT
GAAGAAATGGGTCCTCGCATGGATCTACGGGTTGGTCGTGTCAGAGAACCCGACCAATCCATGCTCAAGGAGGCT
ATGCGCAAGGCCCGTGGCACCGAGGAAAAGACCAAGAAGAACATTTCAACCGATACCATGGGTGACAAGCTCGGC
CGTGTACATTTGGGAAGGCAGGACCTAGGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACAT
GACGAGCCTCACGACAATGTCGATTCTGATGCAAAAAATGCAAAAAAATCCAAAACTATGTCATGA
Gene >OphauB2|5456
ATGCTTCGCCAAGTGTAAGTATACGTATGCTCCGTCTTCTGACAAGCCAGCTTAAACTTTTTTTTTACAGCAAAC
CCCGCAACGCTCGCTCGAAGCGGGCTCTCGAGAAGCGCGAGCCCAAAACCGTCGAGAACCCCAAGACATGCCTCT
TCCTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTCTACTCGCTCCGACAGCCCTTCG
CCAAGAAATTCTCAAAGAAAAATGCCATTCACCCGTTCGAAGACGCCTCATCATTAGAATTCTTTGCTGAAAAGA
ACGATACCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGTCCACATGCCCTCACCTTTGCCCGTACCTTTG
GAAACCGTCTGCTCGACATGCTTGAACTCTACCTTGACCCACAATCTTTTCGTTGCATGGCCCAATTCAAGACCA
AAAAGGTTGCCATCGGTTTGCGACCAATGATTCTCTTTGCCGGTACCCCTTTTGAGAGCCCCGTGAGCAATGAAT
ACACCTTGGCAAAGAGCCTACTTTTAGACTTTTTCAAAGGTGATGTCTCCTCGGGCCAGATTGATGTGGAAGGCT
TGCAATACATCATCTCTATTTCAAGCGAGCAAGAGATTGCTTCCGATGGCGATATCAAGCCTCCCATTCGGATCC
GCGCCTACCTCATTCGCACTCTACGCAGTGGTCAGAAGCTTCCTCGCGTCGAGCTTGAAGAAATGGGTCCTCGCA
TGGATCTACGGGTTGGTCGTGTCAGAGAACCCGACCAATCCATGCTCAAGGAGGCTATGCGCAAGGCCCGTGGCA
CCGAGGAAAAGACCAAGAAGAACATTTCAACCGATACCATGGGTGACAAGCTCGGCCGTGTACATTTGGGAAGGC
AGGACCTAGGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACATGACGAGCCTCACGACAATG
TCGATTCTGATGCAAAAAATGCAAAAAAATCCAAAACTATGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail