Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5445
Gene name
LocationContig_42:26487..29676
Strand+
Gene length (bp)3189
Transcript length (bp)3123
Coding sequence length (bp)3123
Protein length (aa) 1041

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.5E-38 226 596
PF14558 TRP_N ML-like domain 9.3E-25 23 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94543|YCD3_SCHPO Uncharacterized membrane protein C1322.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.03 PE=3 SV=1 128 854 9.0E-53

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 171 193 22
3 214 236 22
4 347 369 22
5 395 417 22
6 427 449 22
7 501 523 22
8 538 560 22
9 567 589 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5445
MARRCLLVVVMLVACGAGPAAAVRVNVTNCLPEWHQSSSPPYLQWQPLYADAAFDTVKDSHKLRLTVWGNVTGSM
ERIQLPPPSDDYWRNAKETKGKIVDTADPDADDKRATTLFQRVRVLTYEPWHNRTSFCSSGLDNGTCPLGPVFGL
DVGEANFAQGLVPSVTLSHDFYSSYAFASFAATMLIIYGNHEGTNIGCMSATITPDLGGLSKTLRFLPLAILGFT
AFAVTIAGALSPWGTTNMLHWSTNYGRDVDLLRLVTPGFGDCLQYIQFIFLTGGLSLSYPGFYQPVVSQVAWSSL
VFNESLVTRGPAWQSVVDGIYVTDAGYGLHQLAQLAGMSGSADLWPGMMVWLCAMVAGVFVLSQGGFLVQWLWRR
VKGIAEEDLRAKKMPFSMGNVVRIVFNYMLMPIVALSTFQLVVARESPPYAVALAVVTLVLLLGFAIWILLAIVQ
TRPKSVLFDDLPTALRYGPLYNTFADEAAGFALIPIVVNVMRGIAIGAVQPSGVAQVVLLAICEVIQLFTLHAFR
PFESSTSMNAYHSLFCVLRAITIMLMVAFVPSLGVTEGPKGWIGYAMLLIHGVVLLLGFLLTALQTVIEVVARML
GAGSHDGTGLRRGGLGKIFGMRQLSRRVTHRGEPWRASQVSTQGMLDSRNGYMMATARARSTSTLAPQRRHRSSS
ALDSVDVYSGAHGNVATSASSYLPGTPAETTTFSFLGPPNQARRCMPVALEASDPYYRPPRPRRETYKDVLPPRR
SLDANMQPGLGPMADAADTADLGNLASMHIPANRPDYMTREVDYYYGVRGPALNSEGPGRKLGTGPADPTGPVAT
ATAWLRSLFTPKTKEKSKGFEVVRSSRMPPAMVRNGGFGDETPPEGIPVAMGVLRNGPIESDDDDDDDDGSSASK
PPCSRGPDDLVSDAGEPCASHAHEALERVRPSPTEDRAGLGVPLATGANTEAEHHLALPQASGLPFERTASQRRL
SSKSSLDFAGELVDVSLAAATGERPASYGMVPHLEINRVDPELPMGDLLGSSAEVIDNSCPDKPT*
Coding >OphauB2|5445
ATGGCGCGGCGGTGCTTGTTGGTGGTGGTGATGCTTGTTGCTTGCGGCGCTGGTCCGGCGGCGGCGGTGCGCGTC
AATGTCACCAACTGCTTACCCGAGTGGCATCAGTCGAGCTCACCGCCCTATTTGCAGTGGCAGCCCCTGTACGCG
GATGCTGCCTTTGACACGGTCAAGGATAGCCACAAGCTTCGGCTGACGGTATGGGGCAACGTGACGGGGTCCATG
GAGCGCATCCAGCTTCCGCCTCCCAGCGACGACTACTGGCGAAACGCCAAGGAAACAAAGGGCAAGATTGTTGAC
ACGGCGGATCCCGACGCTGATGACAAGAGGGCCACGACTTTGTTCCAGCGCGTCCGCGTCCTGACGTATGAGCCC
TGGCACAATCGCACGAGCTTCTGTTCGAGCGGACTCGACAATGGCACCTGTCCGCTGGGACCCGTCTTTGGCCTT
GATGTTGGCGAAGCGAACTTTGCCCAAGGCCTTGTCCCGTCGGTGACTCTGAGCCACGACTTTTACTCGTCGTAT
GCCTTTGCCTCGTTTGCGGCAACAATGCTCATCATCTACGGCAATCACGAAGGCACCAATATTGGCTGCATGTCA
GCCACGATTACGCCTGATCTTGGTGGCCTGTCCAAGACTCTGCGCTTCCTGCCCCTGGCCATTCTTGGCTTCACG
GCCTTTGCAGTGACGATTGCTGGCGCCTTGAGCCCCTGGGGCACCACCAACATGCTGCACTGGTCGACCAACTAT
GGGCGCGATGTCGATCTCTTGCGACTGGTGACGCCCGGCTTTGGCGACTGTCTGCAGTACATTCAGTTCATCTTT
CTCACTGGAGGCCTGTCTCTGAGCTACCCCGGCTTCTACCAGCCCGTGGTCAGCCAGGTTGCATGGTCGTCGCTC
GTCTTCAACGAAAGCCTTGTGACGCGAGGCCCGGCGTGGCAGAGCGTGGTTGACGGCATCTACGTGACGGATGCC
GGCTACGGGCTGCACCAGCTGGCGCAGCTGGCGGGCATGTCTGGCAGCGCCGACTTGTGGCCGGGCATGATGGTG
TGGCTGTGCGCCATGGTGGCGGGCGTCTTTGTGCTGAGCCAAGGCGGCTTCTTGGTGCAGTGGCTCTGGCGCCGC
GTCAAGGGCATTGCCGAGGAAGACTTGCGAGCCAAGAAGATGCCCTTTAGCATGGGCAATGTGGTGCGCATCGTC
TTCAACTACATGCTGATGCCCATTGTGGCTCTGTCCACCTTTCAGCTGGTGGTGGCGCGAGAGTCGCCGCCCTAT
GCCGTGGCGCTGGCCGTGGTGACGCTCGTCCTGCTCTTGGGCTTTGCCATTTGGATTCTCTTGGCCATTGTGCAG
ACGCGGCCCAAGTCGGTCTTGTTTGACGACTTGCCCACGGCGCTGCGCTACGGGCCGCTCTACAACACGTTTGCC
GACGAGGCGGCTGGCTTTGCTCTGATTCCCATTGTGGTGAATGTGATGCGCGGCATTGCCATTGGCGCTGTGCAG
CCGAGCGGAGTGGCGCAGGTGGTGCTGCTGGCCATTTGCGAGGTGATTCAGCTCTTCACCCTGCACGCCTTTCGC
CCCTTTGAGTCGTCCACGTCGATGAATGCCTACCACAGCCTGTTTTGCGTCTTGAGAGCCATTACCATTATGCTC
ATGGTTGCCTTTGTGCCAAGCCTGGGCGTCACCGAGGGCCCCAAGGGCTGGATTGGCTATGCCATGCTGCTCATT
CACGGCGTGGTGCTGCTTCTCGGCTTCTTGCTGACGGCGCTGCAGACGGTGATTGAGGTGGTGGCGCGCATGCTT
GGCGCCGGCAGCCACGACGGCACCGGCCTGAGGCGTGGCGGCCTGGGCAAGATTTTTGGCATGCGCCAGCTGTCG
CGCCGAGTGACGCATCGCGGGGAGCCATGGAGGGCCAGCCAAGTGTCGACGCAGGGCATGCTCGACAGCAGAAAT
GGCTACATGATGGCCACGGCCCGAGCCCGCTCCACCTCCACCTTGGCCCCTCAGCGCCGCCACCGGAGCAGCTCC
GCCCTGGACAGCGTCGATGTCTACTCGGGCGCCCATGGCAACGTGGCCACGTCGGCCAGCTCGTATCTGCCTGGC
ACTCCGGCCGAGACGACCACGTTTTCCTTTCTCGGGCCCCCCAACCAGGCCCGGAGGTGCATGCCCGTTGCCCTC
GAGGCCTCTGACCCGTACTACCGGCCTCCGCGGCCTCGGCGCGAAACCTACAAGGACGTGCTGCCGCCAAGGCGC
TCCCTCGACGCCAACATGCAGCCGGGCCTCGGGCCAATGGCTGATGCTGCCGACACGGCGGACCTGGGCAACTTG
GCCAGCATGCACATTCCTGCCAATCGCCCAGATTACATGACGCGAGAGGTGGACTATTACTATGGCGTCCGTGGT
CCCGCTCTCAACTCGGAGGGACCGGGCCGAAAGCTGGGCACCGGCCCGGCAGATCCCACGGGGCCAGTGGCTACT
GCCACAGCATGGCTCCGGAGCCTCTTCACTCCCAAGACCAAGGAGAAGAGCAAGGGCTTCGAGGTGGTGAGGAGC
TCAAGAATGCCCCCCGCCATGGTGCGCAATGGGGGCTTTGGCGATGAGACGCCTCCCGAGGGCATCCCTGTGGCC
ATGGGCGTCTTGCGAAACGGTCCCATAGAATCCGACGACGACGACGACGACGACGACGGCTCCTCTGCGTCCAAG
CCGCCGTGCAGCAGGGGGCCCGATGACCTTGTTAGCGATGCCGGCGAGCCTTGCGCTTCACATGCCCATGAGGCC
CTAGAGAGAGTGCGCCCCTCTCCCACTGAGGACAGGGCTGGCCTGGGCGTGCCTTTGGCCACTGGCGCAAACACG
GAGGCGGAGCACCACCTCGCCCTGCCCCAAGCATCGGGCCTGCCCTTTGAGCGCACCGCGTCGCAGCGCCGTCTT
TCCTCCAAGTCGTCGCTCGACTTTGCTGGCGAGCTAGTCGACGTGTCGCTTGCCGCCGCCACAGGCGAGCGACCC
GCCAGCTACGGCATGGTGCCGCACCTTGAGATTAACAGAGTCGACCCTGAGCTGCCCATGGGTGACTTGCTCGGC
AGCTCTGCAGAAGTCATTGACAATTCCTGCCCAGACAAGCCCACGTGA
Transcript >OphauB2|5445
ATGGCGCGGCGGTGCTTGTTGGTGGTGGTGATGCTTGTTGCTTGCGGCGCTGGTCCGGCGGCGGCGGTGCGCGTC
AATGTCACCAACTGCTTACCCGAGTGGCATCAGTCGAGCTCACCGCCCTATTTGCAGTGGCAGCCCCTGTACGCG
GATGCTGCCTTTGACACGGTCAAGGATAGCCACAAGCTTCGGCTGACGGTATGGGGCAACGTGACGGGGTCCATG
GAGCGCATCCAGCTTCCGCCTCCCAGCGACGACTACTGGCGAAACGCCAAGGAAACAAAGGGCAAGATTGTTGAC
ACGGCGGATCCCGACGCTGATGACAAGAGGGCCACGACTTTGTTCCAGCGCGTCCGCGTCCTGACGTATGAGCCC
TGGCACAATCGCACGAGCTTCTGTTCGAGCGGACTCGACAATGGCACCTGTCCGCTGGGACCCGTCTTTGGCCTT
GATGTTGGCGAAGCGAACTTTGCCCAAGGCCTTGTCCCGTCGGTGACTCTGAGCCACGACTTTTACTCGTCGTAT
GCCTTTGCCTCGTTTGCGGCAACAATGCTCATCATCTACGGCAATCACGAAGGCACCAATATTGGCTGCATGTCA
GCCACGATTACGCCTGATCTTGGTGGCCTGTCCAAGACTCTGCGCTTCCTGCCCCTGGCCATTCTTGGCTTCACG
GCCTTTGCAGTGACGATTGCTGGCGCCTTGAGCCCCTGGGGCACCACCAACATGCTGCACTGGTCGACCAACTAT
GGGCGCGATGTCGATCTCTTGCGACTGGTGACGCCCGGCTTTGGCGACTGTCTGCAGTACATTCAGTTCATCTTT
CTCACTGGAGGCCTGTCTCTGAGCTACCCCGGCTTCTACCAGCCCGTGGTCAGCCAGGTTGCATGGTCGTCGCTC
GTCTTCAACGAAAGCCTTGTGACGCGAGGCCCGGCGTGGCAGAGCGTGGTTGACGGCATCTACGTGACGGATGCC
GGCTACGGGCTGCACCAGCTGGCGCAGCTGGCGGGCATGTCTGGCAGCGCCGACTTGTGGCCGGGCATGATGGTG
TGGCTGTGCGCCATGGTGGCGGGCGTCTTTGTGCTGAGCCAAGGCGGCTTCTTGGTGCAGTGGCTCTGGCGCCGC
GTCAAGGGCATTGCCGAGGAAGACTTGCGAGCCAAGAAGATGCCCTTTAGCATGGGCAATGTGGTGCGCATCGTC
TTCAACTACATGCTGATGCCCATTGTGGCTCTGTCCACCTTTCAGCTGGTGGTGGCGCGAGAGTCGCCGCCCTAT
GCCGTGGCGCTGGCCGTGGTGACGCTCGTCCTGCTCTTGGGCTTTGCCATTTGGATTCTCTTGGCCATTGTGCAG
ACGCGGCCCAAGTCGGTCTTGTTTGACGACTTGCCCACGGCGCTGCGCTACGGGCCGCTCTACAACACGTTTGCC
GACGAGGCGGCTGGCTTTGCTCTGATTCCCATTGTGGTGAATGTGATGCGCGGCATTGCCATTGGCGCTGTGCAG
CCGAGCGGAGTGGCGCAGGTGGTGCTGCTGGCCATTTGCGAGGTGATTCAGCTCTTCACCCTGCACGCCTTTCGC
CCCTTTGAGTCGTCCACGTCGATGAATGCCTACCACAGCCTGTTTTGCGTCTTGAGAGCCATTACCATTATGCTC
ATGGTTGCCTTTGTGCCAAGCCTGGGCGTCACCGAGGGCCCCAAGGGCTGGATTGGCTATGCCATGCTGCTCATT
CACGGCGTGGTGCTGCTTCTCGGCTTCTTGCTGACGGCGCTGCAGACGGTGATTGAGGTGGTGGCGCGCATGCTT
GGCGCCGGCAGCCACGACGGCACCGGCCTGAGGCGTGGCGGCCTGGGCAAGATTTTTGGCATGCGCCAGCTGTCG
CGCCGAGTGACGCATCGCGGGGAGCCATGGAGGGCCAGCCAAGTGTCGACGCAGGGCATGCTCGACAGCAGAAAT
GGCTACATGATGGCCACGGCCCGAGCCCGCTCCACCTCCACCTTGGCCCCTCAGCGCCGCCACCGGAGCAGCTCC
GCCCTGGACAGCGTCGATGTCTACTCGGGCGCCCATGGCAACGTGGCCACGTCGGCCAGCTCGTATCTGCCTGGC
ACTCCGGCCGAGACGACCACGTTTTCCTTTCTCGGGCCCCCCAACCAGGCCCGGAGGTGCATGCCCGTTGCCCTC
GAGGCCTCTGACCCGTACTACCGGCCTCCGCGGCCTCGGCGCGAAACCTACAAGGACGTGCTGCCGCCAAGGCGC
TCCCTCGACGCCAACATGCAGCCGGGCCTCGGGCCAATGGCTGATGCTGCCGACACGGCGGACCTGGGCAACTTG
GCCAGCATGCACATTCCTGCCAATCGCCCAGATTACATGACGCGAGAGGTGGACTATTACTATGGCGTCCGTGGT
CCCGCTCTCAACTCGGAGGGACCGGGCCGAAAGCTGGGCACCGGCCCGGCAGATCCCACGGGGCCAGTGGCTACT
GCCACAGCATGGCTCCGGAGCCTCTTCACTCCCAAGACCAAGGAGAAGAGCAAGGGCTTCGAGGTGGTGAGGAGC
TCAAGAATGCCCCCCGCCATGGTGCGCAATGGGGGCTTTGGCGATGAGACGCCTCCCGAGGGCATCCCTGTGGCC
ATGGGCGTCTTGCGAAACGGTCCCATAGAATCCGACGACGACGACGACGACGACGACGGCTCCTCTGCGTCCAAG
CCGCCGTGCAGCAGGGGGCCCGATGACCTTGTTAGCGATGCCGGCGAGCCTTGCGCTTCACATGCCCATGAGGCC
CTAGAGAGAGTGCGCCCCTCTCCCACTGAGGACAGGGCTGGCCTGGGCGTGCCTTTGGCCACTGGCGCAAACACG
GAGGCGGAGCACCACCTCGCCCTGCCCCAAGCATCGGGCCTGCCCTTTGAGCGCACCGCGTCGCAGCGCCGTCTT
TCCTCCAAGTCGTCGCTCGACTTTGCTGGCGAGCTAGTCGACGTGTCGCTTGCCGCCGCCACAGGCGAGCGACCC
GCCAGCTACGGCATGGTGCCGCACCTTGAGATTAACAGAGTCGACCCTGAGCTGCCCATGGGTGACTTGCTCGGC
AGCTCTGCAGAAGTCATTGACAATTCCTGCCCAGACAAGCCCACGTGA
Gene >OphauB2|5445
ATGGCGCGGCGGTGCTTGTTGGTGGTGGTGATGCTTGTTGCTTGCGGCGCTGGTCCGGCGGCGGCGGTGCGCGTC
AATGTCACCAACTGCTTACCCGAGTGGCATCAGTCGAGCTCACCGCCCTATTTGCAGTGGCAGCCCCTGTACGCG
GATGCTGCCTTTGACACGGTCAAGGATAGCCACAAGCTTCGGCTGACGGTATGGGGCAACGTGACGGGGTCCATG
GAGCGCATCCAGCTTCCGCCTCCCAGCGACGACTACTGGCGAAACGCCAAGGAAACAAAGGGCAAGATTGTTGAC
ACGGCGGATCCCGACGCTGATGACAAGAGGGCCACGACTTTGTTCCAGCGCGTCCGCGTCCTGACGTATGAGCCC
TGGCACAATCGCACGAGCTTCTGTTCGAGCGGACTCGACAATGGCACCTGTCCGCTGGGACCCGTCTTTGGCCTT
GATGTTGGCGAAGCGTAGGCTTGAGCTACTCCCCCCCCCCCCCCCCCCCACGACGGGCAACGCGGCTAATGAGGT
GGCAGGAACTTTGCCCAAGGCCTTGTCCCGTCGGTGACTCTGAGCCACGACTTTTACTCGTCGTATGCCTTTGCC
TCGTTTGCGGCAACAATGCTCATCATCTACGGCAATCACGAAGGCACCAATATTGGCTGCATGTCAGCCACGATT
ACGCCTGATCTTGGTGGCCTGTCCAAGACTCTGCGCTTCCTGCCCCTGGCCATTCTTGGCTTCACGGCCTTTGCA
GTGACGATTGCTGGCGCCTTGAGCCCCTGGGGCACCACCAACATGCTGCACTGGTCGACCAACTATGGGCGCGAT
GTCGATCTCTTGCGACTGGTGACGCCCGGCTTTGGCGACTGTCTGCAGTACATTCAGTTCATCTTTCTCACTGGA
GGCCTGTCTCTGAGCTACCCCGGCTTCTACCAGCCCGTGGTCAGCCAGGTTGCATGGTCGTCGCTCGTCTTCAAC
GAAAGCCTTGTGACGCGAGGCCCGGCGTGGCAGAGCGTGGTTGACGGCATCTACGTGACGGATGCCGGCTACGGG
CTGCACCAGCTGGCGCAGCTGGCGGGCATGTCTGGCAGCGCCGACTTGTGGCCGGGCATGATGGTGTGGCTGTGC
GCCATGGTGGCGGGCGTCTTTGTGCTGAGCCAAGGCGGCTTCTTGGTGCAGTGGCTCTGGCGCCGCGTCAAGGGC
ATTGCCGAGGAAGACTTGCGAGCCAAGAAGATGCCCTTTAGCATGGGCAATGTGGTGCGCATCGTCTTCAACTAC
ATGCTGATGCCCATTGTGGCTCTGTCCACCTTTCAGCTGGTGGTGGCGCGAGAGTCGCCGCCCTATGCCGTGGCG
CTGGCCGTGGTGACGCTCGTCCTGCTCTTGGGCTTTGCCATTTGGATTCTCTTGGCCATTGTGCAGACGCGGCCC
AAGTCGGTCTTGTTTGACGACTTGCCCACGGCGCTGCGCTACGGGCCGCTCTACAACACGTTTGCCGACGAGGCG
GCTGGCTTTGCTCTGATTCCCATTGTGGTGAATGTGATGCGCGGCATTGCCATTGGCGCTGTGCAGCCGAGCGGA
GTGGCGCAGGTGGTGCTGCTGGCCATTTGCGAGGTGATTCAGCTCTTCACCCTGCACGCCTTTCGCCCCTTTGAG
TCGTCCACGTCGATGAATGCCTACCACAGCCTGTTTTGCGTCTTGAGAGCCATTACCATTATGCTCATGGTTGCC
TTTGTGCCAAGCCTGGGCGTCACCGAGGGCCCCAAGGGCTGGATTGGCTATGCCATGCTGCTCATTCACGGCGTG
GTGCTGCTTCTCGGCTTCTTGCTGACGGCGCTGCAGACGGTGATTGAGGTGGTGGCGCGCATGCTTGGCGCCGGC
AGCCACGACGGCACCGGCCTGAGGCGTGGCGGCCTGGGCAAGATTTTTGGCATGCGCCAGCTGTCGCGCCGAGTG
ACGCATCGCGGGGAGCCATGGAGGGCCAGCCAAGTGTCGACGCAGGGCATGCTCGACAGCAGAAATGGCTACATG
ATGGCCACGGCCCGAGCCCGCTCCACCTCCACCTTGGCCCCTCAGCGCCGCCACCGGAGCAGCTCCGCCCTGGAC
AGCGTCGATGTCTACTCGGGCGCCCATGGCAACGTGGCCACGTCGGCCAGCTCGTATCTGCCTGGCACTCCGGCC
GAGACGACCACGTTTTCCTTTCTCGGGCCCCCCAACCAGGCCCGGAGGTGCATGCCCGTTGCCCTCGAGGCCTCT
GACCCGTACTACCGGCCTCCGCGGCCTCGGCGCGAAACCTACAAGGACGTGCTGCCGCCAAGGCGCTCCCTCGAC
GCCAACATGCAGCCGGGCCTCGGGCCAATGGCTGATGCTGCCGACACGGCGGACCTGGGCAACTTGGCCAGCATG
CACATTCCTGCCAATCGCCCAGATTACATGACGCGAGAGGTGGACTATTACTATGGCGTCCGTGGTCCCGCTCTC
AACTCGGAGGGACCGGGCCGAAAGCTGGGCACCGGCCCGGCAGATCCCACGGGGCCAGTGGCTACTGCCACAGCA
TGGCTCCGGAGCCTCTTCACTCCCAAGACCAAGGAGAAGAGCAAGGGCTTCGAGGTGGTGAGGAGCTCAAGAATG
CCCCCCGCCATGGTGCGCAATGGGGGCTTTGGCGATGAGACGCCTCCCGAGGGCATCCCTGTGGCCATGGGCGTC
TTGCGAAACGGTCCCATAGAATCCGACGACGACGACGACGACGACGACGGCTCCTCTGCGTCCAAGCCGCCGTGC
AGCAGGGGGCCCGATGACCTTGTTAGCGATGCCGGCGAGCCTTGCGCTTCACATGCCCATGAGGCCCTAGAGAGA
GTGCGCCCCTCTCCCACTGAGGACAGGGCTGGCCTGGGCGTGCCTTTGGCCACTGGCGCAAACACGGAGGCGGAG
CACCACCTCGCCCTGCCCCAAGCATCGGGCCTGCCCTTTGAGCGCACCGCGTCGCAGCGCCGTCTTTCCTCCAAG
TCGTCGCTCGACTTTGCTGGCGAGCTAGTCGACGTGTCGCTTGCCGCCGCCACAGGCGAGCGACCCGCCAGCTAC
GGCATGGTGCCGCACCTTGAGATTAACAGAGTCGACCCTGAGCTGCCCATGGGTGACTTGCTCGGCAGCTCTGCA
GAAGTCATTGACAATTCCTGCCCAGACAAGCCCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail