Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5437
Gene name
LocationContig_418:340..2116
Strand+
Gene length (bp)1776
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 5.9E-117 199 485
PF10348 DUF2427 Domain of unknown function (DUF2427) 2.4E-20 1 79

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 1 488 4.0E-82
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 200 486 3.0E-66

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 60 82 22
3 194 213 19
4 223 245 22
5 265 287 22
6 307 329 22
7 359 378 19
8 393 415 22
9 428 446 18
10 461 483 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5437
MIFAWVVILPVAVMLSLVGSRFTIPWQFGFTITHAVGLLFVIMYKADTPDLYPHNAHHNIGWIATGLVPAQIIIG
LAEHMAASVRRRSLRRAHLASAEERCYFIPDGEYRISSESCQGIESSTGNLPSSWDTTLQCREQDWDKECDSNDA
QLSQSKLNLFRMHILRQLAVKVSWLVSSRTWRYFDLLYRITDRIILPFGFVVVTTGVATFGRFFEDRAIFSGLAH
WIKGGVFFWLGLFTLGRWCGSFAELGWAWNARPRAKWNKWYPSTEFVESALIFLYGSTNIFLEHLGRWGGDWTAQ
DLQHLAITILFIGGGLCGMLVESTFIRVLLNMTASQVSMVPINHESAHEEQQQPDTYEFSLNPIPALVILLVGII
MSSHHQSSHISTTVHRQWGNLLLGASFTRTLTYLLIYLRPPKSTLPSRPPTELLAAFGLIAGGIVFMASSSDTIQ
AIIDYDLDAMFIYTMTMGLVALLMAWEVLVLALKGWAAHCERRLDPS*
Coding >OphauB2|5437
ATGATTTTTGCTTGGGTCGTTATTCTCCCCGTCGCTGTGATGCTATCACTCGTAGGGTCTCGCTTCACAATACCT
TGGCAATTCGGCTTTACAATCACACATGCCGTTGGTCTCTTATTCGTCATCATGTATAAGGCTGACACACCAGAC
CTGTACCCTCACAATGCCCACCATAATATTGGCTGGATTGCTACTGGGCTTGTACCGGCGCAAATAATAATTGGT
TTGGCTGAGCATATGGCCGCGTCAGTGCGCAGGCGTTCTTTGCGCCGTGCTCACTTGGCCAGCGCTGAAGAGAGA
TGCTACTTTATACCAGACGGCGAATATCGCATTTCCAGTGAAAGTTGCCAGGGTATCGAGTCCAGCACTGGCAAC
CTACCTAGTAGCTGGGACACCACGTTGCAGTGCCGTGAGCAAGACTGGGACAAGGAATGCGATTCCAATGATGCC
CAACTCTCGCAAAGCAAATTGAACCTATTTCGGATGCATATATTAAGACAGCTGGCTGTTAAGGTGTCTTGGCTC
GTTTCCTCGCGGACTTGGCGGTACTTCGACCTGTTATATCGCATTACCGATCGTATTATTTTGCCATTTGGCTTC
GTCGTCGTTACCACGGGTGTCGCCACGTTTGGTCGTTTCTTCGAGGACCGCGCAATATTCAGTGGGTTAGCCCAT
TGGATTAAAGGAGGCGTCTTTTTCTGGCTGGGTCTTTTCACTCTTGGTCGCTGGTGCGGCAGTTTTGCAGAGCTA
GGCTGGGCTTGGAACGCCCGTCCGCGAGCAAAGTGGAACAAGTGGTATCCATCGACTGAGTTCGTTGAGAGCGCG
CTTATCTTTCTATATGGCTCCACGAACATTTTTCTCGAACATCTGGGCCGCTGGGGCGGCGACTGGACTGCCCAG
GACCTGCAGCATCTTGCCATCACTATACTTTTTATTGGCGGCGGTCTGTGCGGCATGCTAGTCGAGTCGACTTTT
ATTCGTGTACTGCTCAATATGACTGCATCCCAGGTATCAATGGTACCCATTAATCACGAATCAGCTCACGAGGAA
CAGCAGCAACCAGACACATATGAATTTTCTTTGAATCCCATTCCGGCCCTAGTCATTCTCTTAGTGGGCATCATA
ATGAGCTCTCATCACCAGTCGTCTCATATTTCCACTACCGTGCACAGACAGTGGGGAAATCTCCTGCTGGGTGCT
TCATTTACTCGAACACTCACATATCTTCTTATCTATCTGCGCCCACCCAAATCTACCCTACCATCTAGACCACCC
ACTGAGTTGTTGGCTGCTTTTGGTCTTATCGCTGGAGGCATCGTTTTCATGGCAAGCAGCTCCGACACAATACAA
GCCATAATAGATTACGACCTAGACGCAATGTTTATATATACGATGACTATGGGCCTTGTTGCCTTGCTCATGGCT
TGGGAGGTCCTGGTGTTGGCCTTAAAGGGCTGGGCTGCTCACTGCGAGAGAAGACTTGACCCGTCATAG
Transcript >OphauB2|5437
ATGATTTTTGCTTGGGTCGTTATTCTCCCCGTCGCTGTGATGCTATCACTCGTAGGGTCTCGCTTCACAATACCT
TGGCAATTCGGCTTTACAATCACACATGCCGTTGGTCTCTTATTCGTCATCATGTATAAGGCTGACACACCAGAC
CTGTACCCTCACAATGCCCACCATAATATTGGCTGGATTGCTACTGGGCTTGTACCGGCGCAAATAATAATTGGT
TTGGCTGAGCATATGGCCGCGTCAGTGCGCAGGCGTTCTTTGCGCCGTGCTCACTTGGCCAGCGCTGAAGAGAGA
TGCTACTTTATACCAGACGGCGAATATCGCATTTCCAGTGAAAGTTGCCAGGGTATCGAGTCCAGCACTGGCAAC
CTACCTAGTAGCTGGGACACCACGTTGCAGTGCCGTGAGCAAGACTGGGACAAGGAATGCGATTCCAATGATGCC
CAACTCTCGCAAAGCAAATTGAACCTATTTCGGATGCATATATTAAGACAGCTGGCTGTTAAGGTGTCTTGGCTC
GTTTCCTCGCGGACTTGGCGGTACTTCGACCTGTTATATCGCATTACCGATCGTATTATTTTGCCATTTGGCTTC
GTCGTCGTTACCACGGGTGTCGCCACGTTTGGTCGTTTCTTCGAGGACCGCGCAATATTCAGTGGGTTAGCCCAT
TGGATTAAAGGAGGCGTCTTTTTCTGGCTGGGTCTTTTCACTCTTGGTCGCTGGTGCGGCAGTTTTGCAGAGCTA
GGCTGGGCTTGGAACGCCCGTCCGCGAGCAAAGTGGAACAAGTGGTATCCATCGACTGAGTTCGTTGAGAGCGCG
CTTATCTTTCTATATGGCTCCACGAACATTTTTCTCGAACATCTGGGCCGCTGGGGCGGCGACTGGACTGCCCAG
GACCTGCAGCATCTTGCCATCACTATACTTTTTATTGGCGGCGGTCTGTGCGGCATGCTAGTCGAGTCGACTTTT
ATTCGTGTACTGCTCAATATGACTGCATCCCAGGTATCAATGGTACCCATTAATCACGAATCAGCTCACGAGGAA
CAGCAGCAACCAGACACATATGAATTTTCTTTGAATCCCATTCCGGCCCTAGTCATTCTCTTAGTGGGCATCATA
ATGAGCTCTCATCACCAGTCGTCTCATATTTCCACTACCGTGCACAGACAGTGGGGAAATCTCCTGCTGGGTGCT
TCATTTACTCGAACACTCACATATCTTCTTATCTATCTGCGCCCACCCAAATCTACCCTACCATCTAGACCACCC
ACTGAGTTGTTGGCTGCTTTTGGTCTTATCGCTGGAGGCATCGTTTTCATGGCAAGCAGCTCCGACACAATACAA
GCCATAATAGATTACGACCTAGACGCAATGTTTATATATACGATGACTATGGGCCTTGTTGCCTTGCTCATGGCT
TGGGAGGTCCTGGTGTTGGCCTTAAAGGGCTGGGCTGCTCACTGCGAGAGAAGACTTGACCCGTCATAG
Gene >OphauB2|5437
ATGATTTTTGCTTGGGTCGTTATTCTCCCCGTCGGTACGTGTACCGACCGACTATTGTGTCCCCTTGGCCTCGTT
GACTAACTTTCAGATTCTTATTCCAGCTGTGATGCTATCACTCGTAGGGTCTCGCTTCACAATACCTTGGCAATT
CGGCTTTACAATCACACATGCCGTTGGTCTCTTATTCGTCATCATGTATAAGGCTGACACACCAGACCTGTACCC
TCACAATGCCCACCATAATATTGGCTGGATTGCTACTGGGCTTGTACCGGCGCAAATAATAATTGGTTTGGCTGA
GCATATGGCCGCGTCAGTGCGCAGGCGTTCTTTGCGCCGTGCTCACTTGGCCAGCGCTGAAGAGAGATGCTACTT
TATACCAGACGGCGAATATCGCATTTCCAGTGAAAGTTGCCAGGGTATCGAGTCCAGCACTGGCAACCTACCTAG
TAGCTGGGACACCACGTTGCAGTGCCGTGAGCAAGACTGGGACAAGGAATGCGATTCCAATGATGCCCAACTCTC
GCAAAGCAAATTGAACCTATTTCGGATGCATATATTAAGACAGCTGGCTGTTAAGGTGTCTTGGCTCGTTTCCTC
GCGGACTTGGCGGTACTTCGACCTGTTATATCGCATTACCGATCGTATTATTTTGCCATTTGGCTTCGTCGTCGT
TACCACGGGTGTCGCCACGTTTGGTCGTTTCTTCGTGAGTAATATAATAATAGGCTTCAAAGCCCAGCTACTGAC
AATGATTTGCACAGGAGGACCGCGCAATATTCAGTGGGTTAGCCCATTGGATTAAAGGAGGCGTCTTTTTCTGGC
TGGGTCTTTTCACTCTTGGTCGCTGGTGCGGCAGTTTTGCAGAGCTAGGCTGGGCTTGGAACGCCCGTCCGCGAG
CAAAGTGGAACAAGTGGTATCCATCGACTGAGTTCGTTGAGAGCGCGCTTATCTTTCTATATGGCTCCACGAACA
TTTTTCTCGAACATCTGGGCCGCTGGGGCGGCGACTGGACTGCCCAGGACCTGCAGCATCTTGCCATCACTATAC
TTTTTATTGGCGGCGGTCTGGTAAGCATGTTCTTGTTTTCTACACCCAATCTTGCATTCAGAATGACGACGGCTT
GACTTTGTCTTGCCTTCTCGATATTGGTACACTGACCATGGTGCAGTGCGGCATGCTAGTCGAGTCGACTTTTAT
TCGTGTACTGCTCAATATGACTGCATCCCAGGTATCAATGGTACCCATTAATCACGAATCAGCTCACGAGGAACA
GCAGCAACCAGACACATATGAATTTTCTTTGAATCCCATTCCGGCCCTAGTCATTCTCTTAGTGGGCATCATAAT
GAGCTCTCATCACCAGTCGTCTCATATTTCCACTACCGTGCACAGACAGTGGGGAAATCTCCTGCTGGGTGCTTC
ATTTACTCGAACACTCACATATCTTCTTATCTATCTGCGCCCACCCAAATCTACCCTACCATCTAGACCACCCAC
TGAGTTGTTGGCTGCTTTTGGTCTTATCGCTGGAGGCATCGTTTTCATGGCAAGCGTAAGTCACGGTTTGTGATG
ATTCAAGCTGTCCACTTGCTGCTAATGACTTGCCGCCAGAGCTCCGACACAATACAAGCCATAATAGATTACGAC
CTAGACGCAATGTTTATATATACGATGACTATGGGCCTTGTTGCCTTGCTCATGGCTTGGGAGGTCCTGGTGTTG
GCCTTAAAGGGCTGGGCTGCTCACTGCGAGAGAAGACTTGACCCGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail