Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5432
Gene name
LocationContig_411:949..2713
Strand-
Gene length (bp)1764
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10263 SprT-like SprT-like family 4.4E-36 309 440
PF17283 Zn_ribbon_SprT SprT-like zinc ribbon domain 2.5E-09 446 483

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42953|YGM4_SCHPO HMG box-containing protein C19G7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19G7.04 PE=4 SV=2 298 536 4.0E-40
sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo sapiens GN=ACRC PE=2 SV=1 330 493 7.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5432
MSRTTCLEDIKSDRKSDQPYSRGYSIGDKNDIRPKDSQESFTHNSYPDNSPNSATENQSEGDVCDREETSSVYQT
ATEDLTSNEIDSDCVRDEAAKDLVSTHAPVIETETDSILNRSGSIYFDSQPNESSFEARPQLRKPFGKHLRQNRY
ENPKLERHQDEGVMSRLQQEATRTQTESSSETEFSTLSTRPQTRPLGLEIMPRESLEGSHKMEELAVSTSSLDTS
SLSLIDSSGEVVAASEDQIELPFMTPRKKQANAPSLTLPCELPGNLKTSDRPSALAPWGKVAPVKPSPNKQTRNI
FDKSKDTFAKDFLSELDAKITKGEIARMTQLTGGVKVIWTKSLNTTAGRANWRQETGQSRLVDGAAKLEQRHHAS
IELAEKVINDESKLLNVVAHEFCHLANFMISGVNNRPHGSEFQAWAAKCSRAFGKSHGIHVTTRHTYEIDFRFVW
RCTSCDYEYKRHSRSINPGRHGCGNCKGILKQIKPVPRVAKGGATGNRVGKPNQYQTFVKQHMKTVRKENPGSPQ
KDLMKMVAERWALDKKRAKIESIAKSDKEDVGGVVDQMEQLTLNQ*
Coding >OphauB2|5432
ATGAGTCGTACCACATGTTTAGAAGATATCAAATCAGACCGGAAATCGGACCAGCCTTATTCGCGCGGCTACTCT
ATCGGAGACAAGAATGATATTCGTCCAAAGGATAGTCAGGAGTCTTTCACGCATAATTCATACCCCGACAACAGC
CCCAACTCTGCTACAGAGAATCAAAGCGAGGGGGATGTGTGTGACAGAGAAGAAACTTCCAGCGTATATCAAACT
GCGACTGAGGATTTAACAAGCAACGAAATTGACAGCGACTGTGTCCGCGATGAGGCTGCCAAAGACCTGGTTAGC
ACGCACGCACCAGTTATTGAGACAGAGACAGATTCCATCTTGAATCGGAGTGGCAGCATTTATTTCGACTCGCAG
CCAAATGAATCAAGTTTTGAAGCCAGACCCCAATTAAGGAAGCCATTTGGCAAGCATTTACGGCAGAATCGATAT
GAAAACCCCAAATTGGAGCGCCACCAAGATGAAGGCGTGATGTCAAGGTTACAACAAGAAGCCACCAGAACTCAG
ACAGAGAGCTCAAGTGAGACAGAGTTCAGCACACTGTCTACTAGGCCCCAAACTCGGCCCCTGGGTTTAGAAATA
ATGCCGCGTGAATCATTGGAAGGATCTCACAAGATGGAAGAATTGGCAGTTTCAACGAGCAGCCTTGATACAAGC
TCATTGTCACTGATTGACTCGTCGGGTGAGGTTGTAGCAGCCAGCGAGGATCAAATCGAATTGCCGTTCATGACG
CCTCGCAAAAAGCAGGCGAATGCTCCAAGCCTTACTTTACCATGCGAGCTGCCCGGGAATTTGAAGACGTCTGAT
AGACCAAGCGCACTTGCTCCCTGGGGCAAGGTGGCACCAGTCAAGCCGAGCCCGAACAAACAAACTAGGAACATA
TTTGACAAGAGCAAAGACACCTTTGCCAAGGATTTTCTAAGCGAGCTCGATGCCAAGATTACCAAAGGAGAAATT
GCTCGAATGACTCAGTTGACGGGCGGCGTCAAGGTCATATGGACCAAGTCGCTGAATACGACAGCTGGCAGAGCT
AACTGGCGTCAAGAGACGGGACAAAGCAGGCTAGTAGACGGTGCGGCCAAATTGGAGCAAAGGCATCACGCATCA
ATCGAATTGGCCGAAAAGGTGATCAACGACGAGAGCAAACTATTAAATGTAGTAGCTCACGAGTTCTGCCACTTG
GCCAACTTTATGATTAGTGGCGTCAATAATAGGCCGCACGGATCCGAATTCCAAGCATGGGCAGCTAAGTGCTCA
CGAGCTTTTGGAAAGTCGCACGGTATCCATGTGACAACTAGGCATACATACGAAATCGACTTTAGATTTGTGTGG
AGGTGTACTAGTTGCGACTATGAGTATAAACGACACTCAAGAAGTATCAACCCGGGACGACATGGGTGCGGCAAC
TGCAAAGGCATCCTCAAGCAGATCAAACCAGTACCTCGTGTTGCCAAAGGCGGCGCGACTGGGAATCGAGTCGGC
AAGCCCAACCAGTATCAGACTTTTGTGAAGCAGCACATGAAAACAGTGAGGAAGGAGAACCCAGGCAGTCCACAG
AAAGACTTGATGAAAATGGTGGCTGAACGATGGGCTCTTGACAAAAAGAGGGCTAAGATTGAGAGCATCGCCAAG
TCTGACAAAGAGGATGTTGGCGGCGTTGTTGACCAGATGGAACAATTGACTCTCAATCAATAA
Transcript >OphauB2|5432
ATGAGTCGTACCACATGTTTAGAAGATATCAAATCAGACCGGAAATCGGACCAGCCTTATTCGCGCGGCTACTCT
ATCGGAGACAAGAATGATATTCGTCCAAAGGATAGTCAGGAGTCTTTCACGCATAATTCATACCCCGACAACAGC
CCCAACTCTGCTACAGAGAATCAAAGCGAGGGGGATGTGTGTGACAGAGAAGAAACTTCCAGCGTATATCAAACT
GCGACTGAGGATTTAACAAGCAACGAAATTGACAGCGACTGTGTCCGCGATGAGGCTGCCAAAGACCTGGTTAGC
ACGCACGCACCAGTTATTGAGACAGAGACAGATTCCATCTTGAATCGGAGTGGCAGCATTTATTTCGACTCGCAG
CCAAATGAATCAAGTTTTGAAGCCAGACCCCAATTAAGGAAGCCATTTGGCAAGCATTTACGGCAGAATCGATAT
GAAAACCCCAAATTGGAGCGCCACCAAGATGAAGGCGTGATGTCAAGGTTACAACAAGAAGCCACCAGAACTCAG
ACAGAGAGCTCAAGTGAGACAGAGTTCAGCACACTGTCTACTAGGCCCCAAACTCGGCCCCTGGGTTTAGAAATA
ATGCCGCGTGAATCATTGGAAGGATCTCACAAGATGGAAGAATTGGCAGTTTCAACGAGCAGCCTTGATACAAGC
TCATTGTCACTGATTGACTCGTCGGGTGAGGTTGTAGCAGCCAGCGAGGATCAAATCGAATTGCCGTTCATGACG
CCTCGCAAAAAGCAGGCGAATGCTCCAAGCCTTACTTTACCATGCGAGCTGCCCGGGAATTTGAAGACGTCTGAT
AGACCAAGCGCACTTGCTCCCTGGGGCAAGGTGGCACCAGTCAAGCCGAGCCCGAACAAACAAACTAGGAACATA
TTTGACAAGAGCAAAGACACCTTTGCCAAGGATTTTCTAAGCGAGCTCGATGCCAAGATTACCAAAGGAGAAATT
GCTCGAATGACTCAGTTGACGGGCGGCGTCAAGGTCATATGGACCAAGTCGCTGAATACGACAGCTGGCAGAGCT
AACTGGCGTCAAGAGACGGGACAAAGCAGGCTAGTAGACGGTGCGGCCAAATTGGAGCAAAGGCATCACGCATCA
ATCGAATTGGCCGAAAAGGTGATCAACGACGAGAGCAAACTATTAAATGTAGTAGCTCACGAGTTCTGCCACTTG
GCCAACTTTATGATTAGTGGCGTCAATAATAGGCCGCACGGATCCGAATTCCAAGCATGGGCAGCTAAGTGCTCA
CGAGCTTTTGGAAAGTCGCACGGTATCCATGTGACAACTAGGCATACATACGAAATCGACTTTAGATTTGTGTGG
AGGTGTACTAGTTGCGACTATGAGTATAAACGACACTCAAGAAGTATCAACCCGGGACGACATGGGTGCGGCAAC
TGCAAAGGCATCCTCAAGCAGATCAAACCAGTACCTCGTGTTGCCAAAGGCGGCGCGACTGGGAATCGAGTCGGC
AAGCCCAACCAGTATCAGACTTTTGTGAAGCAGCACATGAAAACAGTGAGGAAGGAGAACCCAGGCAGTCCACAG
AAAGACTTGATGAAAATGGTGGCTGAACGATGGGCTCTTGACAAAAAGAGGGCTAAGATTGAGAGCATCGCCAAG
TCTGACAAAGAGGATGTTGGCGGCGTTGTTGACCAGATGGAACAATTGACTCTCAATCAATAA
Gene >OphauB2|5432
ATGAGTCGTACCACATGTTTAGAAGATATCAAATCAGACCGGAAATCGGACCAGGTAATCATGCCCAAAGACTGC
AGAAACCCCTTCAACTCACCTATACGTTAGCCTTATTCGCGCGGCTACTCTATCGGAGACAAGAATGATATTCGT
CCAAAGGATAGTCAGGAGTCTTTCACGCATAATTCATACCCCGACAACAGCCCCAACTCTGCTACAGAGAATCAA
AGCGAGGGGGATGTGTGTGACAGAGAAGAAACTTCCAGCGTATATCAAACTGCGACTGAGGATTTAACAAGCAAC
GAAATTGACAGCGACTGTGTCCGCGATGAGGCTGCCAAAGACCTGGTTAGCACGCACGCACCAGTTATTGAGACA
GAGACAGATTCCATCTTGAATCGGAGTGGCAGCATTTATTTCGACTCGCAGCCAAATGAATCAAGTTTTGAAGCC
AGACCCCAATTAAGGAAGCCATTTGGCAAGCATTTACGGCAGAATCGATATGAAAACCCCAAATTGGAGCGCCAC
CAAGATGAAGGCGTGATGTCAAGGTTACAACAAGAAGCCACCAGAACTCAGACAGAGAGCTCAAGTGAGACAGAG
TTCAGCACACTGTCTACTAGGCCCCAAACTCGGCCCCTGGGTTTAGAAATAATGCCGCGTGAATCATTGGAAGGA
TCTCACAAGATGGAAGAATTGGCAGTTTCAACGAGCAGCCTTGATACAAGCTCATTGTCACTGATTGACTCGTCG
GGTGAGGTTGTAGCAGCCAGCGAGGATCAAATCGAATTGCCGTTCATGACGCCTCGCAAAAAGCAGGCGAATGCT
CCAAGCCTTACTTTACCATGCGAGCTGCCCGGGAATTTGAAGACGTCTGATAGACCAAGCGCACTTGCTCCCTGG
GGCAAGGTGGCACCAGTCAAGCCGAGCCCGAACAAACAAACTAGGAACATATTTGACAAGAGCAAAGACACCTTT
GCCAAGGATTTTCTAAGCGAGCTCGATGCCAAGATTACCAAAGGAGAAATTGCTCGAATGACTCAGTTGACGGGC
GGCGTCAAGGTCATATGGACCAAGTCGCTGAATACGACAGCTGGCAGAGCTAACTGGCGTCAAGAGACGGGACAA
AGCAGGCTAGTAGACGGTGCGGCCAAATTGGAGCAAAGGCATCACGCATCAATCGAATTGGCCGAAAAGGTGATC
AACGACGAGAGCAAACTATTAAATGTAGTAGCTCACGAGTTCTGCCACTTGGCCAACTTTATGATTAGTGGCGTC
AATAATAGGCCGCACGGATCCGAATTCCAAGCATGGGCAGCTAAGTGCTCACGAGCTTTTGGAAAGTCGCACGGT
ATCCATGTGACAACTAGGCATACATACGAAATCGACTTTAGATTTGTGTGGAGGTGTACTAGTTGCGACTATGAG
TATAAACGACACTCAAGAAGTATCAACCCGGGACGACATGGGTGCGGCAACTGCAAAGGCATCCTCAAGCAGATC
AAACCAGTACCTCGTGTTGCCAAAGGCGGCGCGACTGGGAATCGAGTCGGCAAGCCCAACCAGTATCAGACTTTT
GTGAAGCAGCACATGAAAACAGTGAGGAAGGAGAACCCAGGCAGTCCACAGAAAGACTTGATGAAAATGGTGGCT
GAACGATGGGCTCTTGACAAAAAGAGGGCTAAGATTGAGAGCATCGCCAAGTCTGACAAAGAGGATGTTGGCGGC
GTTGTTGACCAGATGGAACAATTGACTCTCAATCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail