Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5430
Gene name
LocationContig_41:135001..136981
Strand+
Gene length (bp)1980
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08216 CTNNBL Catenin-beta-like, Arm-motif containing nuclear 2.1E-112 101 405
PF08216 CTNNBL Catenin-beta-like, Arm-motif containing nuclear 2.3E-07 428 472

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUK1|CTBL1_SCHPO Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctnnbl1 PE=1 SV=1 88 404 5.0E-62
sp|Q4V8K2|CTBL1_RAT Beta-catenin-like protein 1 OS=Rattus norvegicus GN=Ctnnbl1 PE=1 SV=1 99 404 1.0E-50
sp|Q8WYA6|CTBL1_HUMAN Beta-catenin-like protein 1 OS=Homo sapiens GN=CTNNBL1 PE=1 SV=1 99 404 3.0E-50
sp|Q9CWL8|CTBL1_MOUSE Beta-catenin-like protein 1 OS=Mus musculus GN=Ctnnbl1 PE=1 SV=1 99 405 9.0E-50
sp|O62703|CTBL1_BOVIN Beta-catenin-like protein 1 OS=Bos taurus GN=CTNNBL1 PE=2 SV=3 99 405 1.0E-49

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1523
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3642
Ophiocordyceps australis map64 (Brazil) OphauB2|5430 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02498
Ophiocordyceps camponoti-rufipedis Ophun1|1346
Ophiocordyceps kimflemingae Ophio5|2671
Ophiocordyceps subramaniannii Hirsu2|11203

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5430
MASVDDIFKSAGVASTKRKIDSIRDPNELYKATKLAANSSSRDSAATHANDAASRDEADVDVDADAEAGPTLPPG
VDDGLEDDDDDEGRFFGGGISKQESQILDYVDRAEAEAPAIPDKIDVSWLRKTTQNLDRRITKNAELRAKHANDP
HKFIASEADLDADIHALAVLAEYPNLYPELATVGLAASLAGLLAHDNTDIAVAAVQVLAELTDDDVAAEEEDWAA
LVDSLVDDAQLVSLLVSNLDRLDDQEADEADRAGVYHILNLVENLCSRPATAARVAVNDDLNRWLLARIRRNDLS
STTAVSQNRQYAAEILAILAQASAETRKYIASRPDDDAIDTLLQLVAPYRRRDAHHGDEAEYVQNLFEALTCLVD
DATAGKPRFLDAEGVELCLLMLRDGKKSRGPGRRRRRGRGXXXXXXXXXXXXAGLHTLQHIDVALAWLVAEDAGA
RGRIEALLAERNEGLAVIASTIKAQRQALDTSDEDGKDMNEMLATLLDFLQ*
Coding >OphauB2|5430
ATGGCAAGCGTCGATGACATCTTCAAGAGCGCCGGCGTGGCCAGCACCAAGCGCAAAATCGACTCCATTCGAGAT
CCCAACGAGCTATACAAGGCCACCAAACTCGCCGCAAATAGTTCCAGTCGCGACTCGGCTGCCACACACGCCAAC
GACGCCGCCAGCCGAGATGAAGCTGATGTCGATGTCGATGCCGATGCCGAGGCTGGCCCCACCCTGCCGCCTGGT
GTTGACGACGGTCTTGAAGACGACGACGATGACGAGGGCCGCTTCTTTGGAGGCGGCATTTCGAAGCAAGAGTCG
CAGATTCTAGACTATGTAGACCGCGCAGAGGCCGAGGCGCCCGCTATTCCTGACAAGATTGACGTTTCGTGGCTG
CGCAAGACGACGCAGAATCTCGACCGCCGCATCACCAAGAACGCGGAGCTTCGCGCCAAGCACGCCAACGACCCG
CACAAGTTTATCGCCAGCGAAGCCGACCTTGACGCCGACATTCACGCCCTCGCTGTTCTCGCAGAGTATCCCAAT
CTCTACCCAGAGCTGGCCACGGTGGGCCTGGCTGCTAGTCTGGCTGGTCTCCTCGCCCACGATAATACCGACATT
GCTGTGGCTGCCGTGCAGGTCCTTGCCGAGCTGACTGATGACGACGTGGCGGCAGAAGAAGAGGACTGGGCCGCG
CTGGTGGACTCGCTCGTAGACGACGCCCAGCTTGTCAGCCTGCTCGTCTCAAACCTGGACCGACTCGACGACCAA
GAAGCCGACGAAGCAGACCGCGCCGGCGTCTACCACATTCTCAACCTGGTGGAAAACCTTTGCTCCCGCCCTGCT
ACTGCCGCTCGCGTTGCTGTCAATGACGACCTTAATCGCTGGCTCCTCGCACGCATCCGCCGCAACGACTTGTCC
AGCACCACGGCTGTTTCCCAGAACCGCCAGTATGCCGCTGAGATTCTTGCAATCCTCGCCCAAGCATCTGCCGAG
ACGCGCAAGTACATTGCCTCGCGCCCCGACGACGACGCCATTGACACTCTGCTGCAACTCGTCGCCCCCTATCGC
CGTCGCGATGCCCATCACGGCGACGAGGCGGAATACGTACAAAACCTCTTTGAAGCATTAACCTGCCTCGTTGAC
GATGCCACCGCCGGCAAGCCACGCTTCTTGGATGCAGAGGGCGTGGAACTCTGTCTCCTTATGCTTCGTGACGGC
AAAAAGAGCCGCGGACCCGGCCGACGACGCAGACGAGGCCGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNCGCTGGCCTGCATACGCTGCAGCACATTGACGTTGCGCTGGCTTGGCTTGTTGCCGAGGATGCGGGCGCA
CGGGGCAGGATTGAGGCGCTGCTTGCCGAGCGCAACGAAGGCCTGGCAGTGATTGCGTCCACCATCAAGGCGCAG
CGCCAGGCCCTCGACACGAGCGACGAAGACGGCAAAGACATGAATGAAATGTTGGCTACACTACTAGACTTTCTG
CAATAG
Transcript >OphauB2|5430
ATGGCAAGCGTCGATGACATCTTCAAGAGCGCCGGCGTGGCCAGCACCAAGCGCAAAATCGACTCCATTCGAGAT
CCCAACGAGCTATACAAGGCCACCAAACTCGCCGCAAATAGTTCCAGTCGCGACTCGGCTGCCACACACGCCAAC
GACGCCGCCAGCCGAGATGAAGCTGATGTCGATGTCGATGCCGATGCCGAGGCTGGCCCCACCCTGCCGCCTGGT
GTTGACGACGGTCTTGAAGACGACGACGATGACGAGGGCCGCTTCTTTGGAGGCGGCATTTCGAAGCAAGAGTCG
CAGATTCTAGACTATGTAGACCGCGCAGAGGCCGAGGCGCCCGCTATTCCTGACAAGATTGACGTTTCGTGGCTG
CGCAAGACGACGCAGAATCTCGACCGCCGCATCACCAAGAACGCGGAGCTTCGCGCCAAGCACGCCAACGACCCG
CACAAGTTTATCGCCAGCGAAGCCGACCTTGACGCCGACATTCACGCCCTCGCTGTTCTCGCAGAGTATCCCAAT
CTCTACCCAGAGCTGGCCACGGTGGGCCTGGCTGCTAGTCTGGCTGGTCTCCTCGCCCACGATAATACCGACATT
GCTGTGGCTGCCGTGCAGGTCCTTGCCGAGCTGACTGATGACGACGTGGCGGCAGAAGAAGAGGACTGGGCCGCG
CTGGTGGACTCGCTCGTAGACGACGCCCAGCTTGTCAGCCTGCTCGTCTCAAACCTGGACCGACTCGACGACCAA
GAAGCCGACGAAGCAGACCGCGCCGGCGTCTACCACATTCTCAACCTGGTGGAAAACCTTTGCTCCCGCCCTGCT
ACTGCCGCTCGCGTTGCTGTCAATGACGACCTTAATCGCTGGCTCCTCGCACGCATCCGCCGCAACGACTTGTCC
AGCACCACGGCTGTTTCCCAGAACCGCCAGTATGCCGCTGAGATTCTTGCAATCCTCGCCCAAGCATCTGCCGAG
ACGCGCAAGTACATTGCCTCGCGCCCCGACGACGACGCCATTGACACTCTGCTGCAACTCGTCGCCCCCTATCGC
CGTCGCGATGCCCATCACGGCGACGAGGCGGAATACGTACAAAACCTCTTTGAAGCATTAACCTGCCTCGTTGAC
GATGCCACCGCCGGCAAGCCACGCTTCTTGGATGCAGAGGGCGTGGAACTCTGTCTCCTTATGCTTCGTGACGGC
AAAAAGAGCCGCGGACCCGGCCGACGACGCAGACGAGGCCGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNCGCTGGCCTGCATACGCTGCAGCACATTGACGTTGCGCTGGCTTGGCTTGTTGCCGAGGATGCGGGCGCA
CGGGGCAGGATTGAGGCGCTGCTTGCCGAGCGCAACGAAGGCCTGGCAGTGATTGCGTCCACCATCAAGGCGCAG
CGCCAGGCCCTCGACACGAGCGACGAAGACGGCAAAGACATGAATGAAATGTTGGCTACACTACTAGACTTTCTG
CAATAG
Gene >OphauB2|5430
ATGGCAAGCGTCGATGACATCTTCAAGGTCTGTTTTCCAAATCGCTTACATCTGTGCACAGCCGGCCGGCAGCAA
AAGCTCACTAGCAACCCCTTCCAGAGCGCCGGCGTGGCCAGCACCAAGCGCAAAATCGACTCCATTCGAGATCCC
AGTTCGTCTCCGCTGCATATAACCCCTAAGAAAAAAAAAAAAAAATACGCGTCACATCGCGCCACGCTAACCTCT
TTGTCATCAAAAAAGACGAGCTATACAAGGCCACCAAACTCGCCGCAAATAGTTCCAGTCGCGACTCGGCTGCCA
CACACGCCAACGACGCCGCCAGCCGAGATGAAGCTGATGTCGATGTCGATGCCGATGCCGAGGCTGGCCCCACCC
TGCCGCCTGGTGTTGACGACGGTCTTGAAGACGACGACGATGACGAGGGCCGCTTCTTTGGAGGCGGCATTTCGA
AGCAAGAGTCGCAGATTCTAGACTATGTAGACCGCGCAGAGGCCGAGGCGCCCGCTATTCCTGACAAGATTGACG
TTTCGTGGCTGCGCAAGACGACGCAGAATCTCGACCGCCGCATCACCAAGAACGCGGAGCTTCGCGCCAAGCACG
CCAACGACCCGCACAAGTTTATCGCCAGCGAAGCCGACCTTGACGCCGACATTCACGCCCTCGCTGTTCTCGCAG
AGTATCCCAATCTCTACCCAGAGCTGGCCACGGTGGGCCTGGCTGCTAGTCTGGCTGGTCTCCTCGCCCACGATA
ATACCGACATTGCTGTGGCTGCCGTGCAGGTCCTTGCCGAGCTGACTGATGACGACGTGGCGGCAGAAGAAGAGG
ACTGGGCCGCGCTGGTGGACTCGCTCGTAGACGACGCCCAGCTTGTCAGCCTGCTCGTCTCAAACCTGGACCGAC
TCGACGACCAAGAAGCCGACGAAGCAGACCGCGCCGGCGTCTACCACATTCTCAACCTGGTGGAAAACCTTTGCT
CCCGCCCTGCTACTGCCGCTCGCGTTGCTGTCAATGACGACCTTAATCGCTGGCTCCTCGCACGCATCCGCCGCA
ACGACTTGTCCAGCACCACGGCTGTTTCCCAGAACCGCCAGTATGCCGCTGAGATTCTTGCAATCCTCGCCCAAG
CATCTGCCGAGACGCGCAAGTACATTGCCTCGCGCCCCGACGACGACGCCATTGACACTCTGCTGCAACTCGTCG
CCCCCTATCGCCGTCGCGATGCCCATCACGGCGACGAGGCGGAATACGTACAAAACCTCTTTGAAGCATTAACCT
GCCTCGTTGACGATGCCACCGCCGGCAAGCCACGCTTCTTGGATGCAGAGGGCGTGGAACTCTGTCTCCTTATGC
TTCGTGACGGCAAAAAGAGCCGCGGTCCTGCCCTCCGCCTCTTGGACCACGCCGCCTCTGCCNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNCCCTTCTCTCCCATCTCCTCGCCCTCTTGGCCTCGATGCTTCGCCTGCTTCCCGCCGACTCGCCCGAGCGCAT
CCGCACGCTGGCCAAGTTTGTGGAAAAGGATTACGCAAAGACGGCGCGTCTTGTTGCTCTGCGCGCCGACTGGGC
CGCACGGGTGCGCCAGGCTGAGGAAAAATATCGGCAGGACCCGGCCGACGACGCAGACGAGGCCGAGGNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCTGGCCTGCATACGCTGCAGCACATTGACGTTGCGCTGGCTTGG
CTTGTTGCCGAGGATGCGGGCGCACGGGGCAGGATTGAGGCGCTGCTTGCCGAGCGCAACGAAGGCCTGGCAGTG
ATTGCGTCCACCATCAAGGCGCAGCGCCAGGCCCTCGACACGAGCGACGAAGACGGCAAAGACATGAATGAAATG
TTGGCTACACTACTAGACTTTCTGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail