Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5428
Gene name
LocationContig_41:127370..129824
Strand-
Gene length (bp)2454
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.9E-50 54 231
PF06421 LepA_C GTP-binding protein LepA C-terminus 4.0E-42 542 647
PF00679 EFG_C Elongation factor G C-terminus 6.0E-18 455 538
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.4E-04 59 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 631 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 42 649 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 42 649 0.0E+00
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 33 649 0.0E+00
sp|C5GRI9|GUF1_AJEDR Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GUF1 PE=3 SV=1 33 649 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 631 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 42 649 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 42 649 0.0E+00
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 33 649 0.0E+00
sp|C5GRI9|GUF1_AJEDR Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GUF1 PE=3 SV=1 33 649 0.0E+00
sp|C6HPI9|GUF1_AJECH Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=GUF1 PE=3 SV=2 24 649 0.0E+00
sp|C0NZL9|GUF1_AJECG Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GUF1 PE=3 SV=1 24 649 0.0E+00
sp|A4QV78|GUF1_MAGO7 Translation factor GUF1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GUF1 PE=3 SV=2 26 649 0.0E+00
sp|A6RGX9|GUF1_AJECN Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GUF1 PE=3 SV=2 24 649 0.0E+00
sp|C0SHD5|GUF1_PARBP Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=GUF1 PE=3 SV=1 11 649 0.0E+00
sp|C1GX39|GUF1_PARBA Translation factor GUF1, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GUF1 PE=3 SV=2 33 649 0.0E+00
sp|C1GGI6|GUF1_PARBD Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=GUF1 PE=3 SV=1 11 649 0.0E+00
sp|Q2U3T4|GUF1_ASPOR Translation factor guf1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=guf1 PE=3 SV=1 32 649 0.0E+00
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 33 649 0.0E+00
sp|A1CLD7|GUF1_ASPCL Translation factor guf1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=guf1 PE=3 SV=1 30 649 0.0E+00
sp|Q0CS42|GUF1_ASPTN Translation factor guf1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=guf1 PE=3 SV=1 40 649 0.0E+00
sp|C4JWU3|GUF1_UNCRE Translation factor GUF1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=GUF1 PE=3 SV=1 27 649 0.0E+00
sp|A2QU25|GUF1_ASPNC Translation factor guf1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=guf1 PE=3 SV=1 12 649 0.0E+00
sp|A1D5Z0|GUF1_NEOFI Translation factor guf1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=guf1 PE=3 SV=1 30 649 0.0E+00
sp|B6H2S6|GUF1_PENRW Translation factor guf1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=guf1 PE=3 SV=1 24 649 0.0E+00
sp|B8MS24|GUF1_TALSN Translation factor guf1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=guf1 PE=3 SV=1 32 649 0.0E+00
sp|Q4WYV0|GUF1_ASPFU Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=guf1 PE=3 SV=2 42 649 0.0E+00
sp|B6QW35|GUF1_TALMQ Translation factor guf1, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=guf1 PE=3 SV=1 1 649 0.0E+00
sp|B0XZZ2|GUF1_ASPFC Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=guf1 PE=3 SV=2 42 649 0.0E+00
sp|C5PCH4|GUF1_COCP7 Translation factor GUF1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=GUF1 PE=3 SV=1 33 649 0.0E+00
sp|Q0V3J4|GUF1_PHANO Translation factor GUF1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUF1 PE=3 SV=2 9 649 0.0E+00
sp|C5FMX6|GUF1_ARTOC Translation factor GUF1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GUF1 PE=3 SV=2 21 649 0.0E+00
sp|C5DN84|GUF1_LACTC Translation factor GUF1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GUF1 PE=3 SV=1 29 649 0.0E+00
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 43 649 0.0E+00
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 40 649 0.0E+00
sp|Q6CUH2|GUF1_KLULA Translation factor GUF1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GUF1 PE=3 SV=1 23 649 0.0E+00
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 42 649 0.0E+00
sp|P46943|GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUF1 PE=1 SV=2 22 649 0.0E+00
sp|Q6BMV8|GUF1_DEBHA Translation factor GUF1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GUF1 PE=3 SV=2 41 649 0.0E+00
sp|C8ZDQ3|GUF1_YEAS8 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GUF1 PE=3 SV=1 22 649 0.0E+00
sp|A7A1H2|GUF1_YEAS7 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=GUF1 PE=3 SV=1 22 649 0.0E+00
sp|B3RHG9|GUF1_YEAS1 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GUF1 PE=3 SV=1 22 649 0.0E+00
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 43 649 0.0E+00
sp|B9WBR8|GUF1_CANDC Translation factor GUF1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GUF1 PE=3 SV=1 41 649 0.0E+00
sp|Q6C255|GUF1_YARLI Translation factor GUF1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GUF1 PE=3 SV=1 6 649 0.0E+00
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 10 649 0.0E+00
sp|Q59P53|GUF1_CANAL Translation factor GUF1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUF1 PE=3 SV=1 41 649 0.0E+00
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 6 649 0.0E+00
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 14 649 0.0E+00
sp|C4YIT6|GUF1_CANAW Translation factor GUF1, mitochondrial OS=Candida albicans (strain WO-1) GN=GUF1 PE=3 SV=1 41 649 0.0E+00
sp|O13869|GUF1_SCHPO Translation factor guf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=guf1 PE=3 SV=2 32 649 0.0E+00
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 5 649 0.0E+00
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 23 649 0.0E+00
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 47 647 0.0E+00
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 42 647 0.0E+00
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 23 643 0.0E+00
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 17 643 0.0E+00
sp|B3RXR7|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1 47 649 0.0E+00
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 25 643 0.0E+00
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 47 647 0.0E+00
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 5 643 0.0E+00
sp|Q5FJP6|LEPA_LACAC Elongation factor 4 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 49 648 0.0E+00
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 8 647 0.0E+00
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 47 647 0.0E+00
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 56 647 0.0E+00
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 55 643 0.0E+00
sp|Q11AY3|LEPA_CHESB Elongation factor 4 OS=Chelativorans sp. (strain BNC1) GN=lepA PE=3 SV=1 46 643 0.0E+00
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|C1D7L2|LEPA_LARHH Elongation factor 4 OS=Laribacter hongkongensis (strain HLHK9) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q8UIQ2|LEPA_AGRFC Elongation factor 4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 53 643 0.0E+00
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 55 648 0.0E+00
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B8J444|LEPA_DESDA Elongation factor 4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lepA PE=3 SV=1 53 643 0.0E+00
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q47EG0|LEPA_DECAR Elongation factor 4 OS=Dechloromonas aromatica (strain RCB) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q044A7|LEPA_LACGA Elongation factor 4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|P60790|LEPA_LACJO Elongation factor 4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 53 643 0.0E+00
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|P37949|LEPA_BACSU Elongation factor 4 OS=Bacillus subtilis (strain 168) GN=lepA PE=3 SV=2 54 647 0.0E+00
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|A1ARG8|LEPA_PELPD Elongation factor 4 OS=Pelobacter propionicus (strain DSM 2379) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 47 647 0.0E+00
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 6 647 0.0E+00
sp|A8YVQ1|LEPA_LACH4 Elongation factor 4 OS=Lactobacillus helveticus (strain DPC 4571) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 55 648 0.0E+00
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q98DV1|LEPA_RHILO Elongation factor 4 OS=Rhizobium loti (strain MAFF303099) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 13 649 0.0E+00
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q0BRZ7|LEPA_GRABC Elongation factor 4 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lepA PE=3 SV=2 50 647 0.0E+00
sp|Q2W0F9|LEPA_MAGSA Elongation factor 4 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 56 648 0.0E+00
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q0HSI9|LEPA_SHESR Elongation factor 4 OS=Shewanella sp. (strain MR-7) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q0HG96|LEPA_SHESM Elongation factor 4 OS=Shewanella sp. (strain MR-4) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|Q9A9F4|LEPA_CAUCR Elongation factor 4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lepA PE=3 SV=2 43 643 0.0E+00
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 47 643 0.0E+00
sp|B1XTL2|LEPA_POLNS Elongation factor 4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|A0KZN4|LEPA_SHESA Elongation factor 4 OS=Shewanella sp. (strain ANA-3) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B8H2Z7|LEPA_CAUCN Elongation factor 4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lepA PE=3 SV=1 47 643 0.0E+00
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|A7Z6W5|LEPA_BACMF Elongation factor 4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|A6WKQ5|LEPA_SHEB8 Elongation factor 4 OS=Shewanella baltica (strain OS185) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|A3D1V4|LEPA_SHEB5 Elongation factor 4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B5ZXQ5|LEPA_RHILW Elongation factor 4 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|A9L5N4|LEPA_SHEB9 Elongation factor 4 OS=Shewanella baltica (strain OS195) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B8EBQ4|LEPA_SHEB2 Elongation factor 4 OS=Shewanella baltica (strain OS223) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q049W8|LEPA_LACDB Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q1G9R4|LEPA_LACDA Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B3R202|LEPA_CUPTR Elongation factor 4 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B2SZV7|LEPA_BURPP Elongation factor 4 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q13VM6|LEPA_BURXL Elongation factor 4 OS=Burkholderia xenovorans (strain LB400) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q28LR4|LEPA_JANSC Elongation factor 4 OS=Jannaschia sp. (strain CCS1) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B3E9R0|LEPA_GEOLS Elongation factor 4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|A5FY07|LEPA_ACICJ Elongation factor 4 OS=Acidiphilium cryptum (strain JF-5) GN=lepA PE=3 SV=1 47 647 0.0E+00
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 50 647 0.0E+00
sp|A9M3J8|LEPA_NEIM0 Elongation factor 4 OS=Neisseria meningitidis serogroup C (strain 053442) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B6IUG3|LEPA_RHOCS Elongation factor 4 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B4RK41|LEPA_NEIG2 Elongation factor 4 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q5F9P9|LEPA_NEIG1 Elongation factor 4 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B8ENL1|LEPA_METSB Elongation factor 4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lepA PE=3 SV=1 47 643 0.0E+00
sp|Q8EH83|LEPA_SHEON Elongation factor 4 OS=Shewanella oneidensis (strain MR-1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 55 643 0.0E+00
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 52 643 0.0E+00
sp|A1KT27|LEPA_NEIMF Elongation factor 4 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q9K055|LEPA_NEIMB Elongation factor 4 OS=Neisseria meningitidis serogroup B (strain MC58) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q9JV65|LEPA_NEIMA Elongation factor 4 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B1ZC10|LEPA_METPB Elongation factor 4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B8IMT0|LEPA_METNO Elongation factor 4 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=lepA PE=3 SV=1 47 643 0.0E+00
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 49 643 0.0E+00
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 50 647 0.0E+00
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 38 648 0.0E+00
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 38 648 0.0E+00
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 38 648 0.0E+00
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q2GJV7|LEPA_ANAPZ Elongation factor 4 OS=Anaplasma phagocytophilum (strain HZ) GN=lepA PE=3 SV=1 55 643 0.0E+00
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|Q16BA3|LEPA_ROSDO Elongation factor 4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 54 648 0.0E+00
sp|Q3J8D2|LEPA_NITOC Elongation factor 4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|A4JCQ9|LEPA_BURVG Elongation factor 4 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 51 647 0.0E+00
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 55 647 0.0E+00
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B7KR78|LEPA_METC4 Elongation factor 4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lepA PE=3 SV=1 52 643 0.0E+00
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 53 647 0.0E+00
sp|Q6G550|LEPA_BARHE Elongation factor 4 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lepA PE=3 SV=1 55 643 0.0E+00
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q3SH47|LEPA_THIDA Elongation factor 4 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lepA PE=3 SV=1 56 647 0.0E+00
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 42 647 0.0E+00
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 53 648 0.0E+00
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 51 643 0.0E+00
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 52 647 0.0E+00
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 54 647 0.0E+00
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 52 647 1.0E-180
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 56 647 1.0E-180
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 53 648 1.0E-180
sp|B0UFE0|LEPA_METS4 Elongation factor 4 OS=Methylobacterium sp. (strain 4-46) GN=lepA PE=3 SV=1 47 643 2.0E-180
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 37 647 2.0E-180
sp|A4G6S1|LEPA_HERAR Elongation factor 4 OS=Herminiimonas arsenicoxydans GN=lepA PE=3 SV=1 52 647 2.0E-180
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 53 648 2.0E-180
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 54 647 2.0E-180
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 54 647 2.0E-180
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 54 647 2.0E-180
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 54 647 2.0E-180
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 55 647 2.0E-180
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 50 643 2.0E-180
sp|Q5FHQ1|LEPA_EHRRG Elongation factor 4 OS=Ehrlichia ruminantium (strain Gardel) GN=lepA PE=3 SV=1 55 643 3.0E-180
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 52 647 3.0E-180
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 52 647 3.0E-180
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 52 647 3.0E-180
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 50 649 4.0E-180
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 54 647 4.0E-180
sp|P56865|LEPA_BORPE Elongation factor 4 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lepA PE=3 SV=2 52 647 4.0E-180
sp|Q5HBH4|LEPA_EHRRW Elongation factor 4 OS=Ehrlichia ruminantium (strain Welgevonden) GN=lepA PE=3 SV=1 55 643 4.0E-180
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 55 643 5.0E-180
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 54 647 5.0E-180
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 53 648 5.0E-180
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 53 647 5.0E-180
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 53 647 5.0E-180
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 53 648 6.0E-180
sp|Q7W5J4|LEPA_BORPA Elongation factor 4 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lepA PE=3 SV=1 52 647 6.0E-180
sp|Q7WD30|LEPA_BORBR Elongation factor 4 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lepA PE=3 SV=1 52 647 6.0E-180
sp|Q0BH06|LEPA_BURCM Elongation factor 4 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lepA PE=3 SV=1 52 647 8.0E-180
sp|B1YVM2|LEPA_BURA4 Elongation factor 4 OS=Burkholderia ambifaria (strain MC40-6) GN=lepA PE=3 SV=1 52 647 8.0E-180
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 52 647 1.0E-179
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 56 647 1.0E-179
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 55 643 2.0E-179
sp|Q7NWC7|LEPA_CHRVO Elongation factor 4 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lepA PE=3 SV=1 52 647 2.0E-179
sp|Q2KWY3|LEPA_BORA1 Elongation factor 4 OS=Bordetella avium (strain 197N) GN=lepA PE=3 SV=1 52 647 2.0E-179
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 50 643 2.0E-179
sp|A9ADE0|LEPA_BURM1 Elongation factor 4 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lepA PE=3 SV=1 52 647 3.0E-179
sp|B1KI55|LEPA_SHEWM Elongation factor 4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lepA PE=3 SV=1 52 647 3.0E-179
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 47 647 3.0E-179
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 52 643 3.0E-179
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 52 643 3.0E-179
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 52 643 3.0E-179
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 52 647 4.0E-179
sp|Q88MY7|LEPA_PSEPK Elongation factor 4 OS=Pseudomonas putida (strain KT2440) GN=lepA PE=3 SV=1 52 647 4.0E-179
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 52 643 5.0E-179
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 31 649 5.0E-179
sp|B8CQJ7|LEPA_SHEPW Elongation factor 4 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lepA PE=3 SV=1 52 647 5.0E-179
sp|A5W8F4|LEPA_PSEP1 Elongation factor 4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lepA PE=3 SV=1 52 647 6.0E-179
sp|Q21XN4|LEPA_RHOFT Elongation factor 4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=lepA PE=3 SV=1 52 647 7.0E-179
sp|A4XSC1|LEPA_PSEMY Elongation factor 4 OS=Pseudomonas mendocina (strain ymp) GN=lepA PE=3 SV=1 52 647 7.0E-179
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 52 647 7.0E-179
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 53 647 8.0E-179
sp|Q47WP3|LEPA_COLP3 Elongation factor 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lepA PE=3 SV=1 52 647 9.0E-179
sp|Q2SXT6|LEPA_BURTA Elongation factor 4 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lepA PE=3 SV=1 52 647 9.0E-179
sp|Q8DM20|LEPA_THEEB Elongation factor 4 OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA PE=3 SV=1 50 647 9.0E-179
sp|Q15R31|LEPA_PSEA6 Elongation factor 4 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lepA PE=3 SV=1 53 647 1.0E-178
sp|Q7NAT2|LEPA_MYCGA Elongation factor 4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lepA PE=3 SV=2 53 647 1.0E-178
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 55 647 1.0E-178
sp|Q5FUC2|LEPA_GLUOX Elongation factor 4 OS=Gluconobacter oxydans (strain 621H) GN=lepA PE=3 SV=2 51 647 1.0E-178
sp|A8Z4C4|LEPA_STAAT Elongation factor 4 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A6QHC7|LEPA_STAAE Elongation factor 4 OS=Staphylococcus aureus (strain Newman) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|Q5HFH6|LEPA_STAAC Elongation factor 4 OS=Staphylococcus aureus (strain COL) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|Q2FXY7|LEPA_STAA8 Elongation factor 4 OS=Staphylococcus aureus (strain NCTC 8325) GN=lepA PE=1 SV=1 42 647 2.0E-178
sp|Q2FGD9|LEPA_STAA3 Elongation factor 4 OS=Staphylococcus aureus (strain USA300) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 54 647 2.0E-178
sp|Q6G8Y3|LEPA_STAAS Elongation factor 4 OS=Staphylococcus aureus (strain MSSA476) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|Q6GGB6|LEPA_STAAR Elongation factor 4 OS=Staphylococcus aureus (strain MRSA252) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|P65272|LEPA_STAAN Elongation factor 4 OS=Staphylococcus aureus (strain N315) GN=lepA PE=1 SV=1 42 647 2.0E-178
sp|P65271|LEPA_STAAM Elongation factor 4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|Q2YT42|LEPA_STAAB Elongation factor 4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A5ITB2|LEPA_STAA9 Elongation factor 4 OS=Staphylococcus aureus (strain JH9) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A6U257|LEPA_STAA2 Elongation factor 4 OS=Staphylococcus aureus (strain JH1) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A7X2Y7|LEPA_STAA1 Elongation factor 4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lepA PE=3 SV=1 42 647 2.0E-178
sp|A3QBS5|LEPA_SHELP Elongation factor 4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lepA PE=3 SV=1 52 647 3.0E-178
sp|Q8NWA7|LEPA_STAAW Elongation factor 4 OS=Staphylococcus aureus (strain MW2) GN=lepA PE=3 SV=1 42 647 3.0E-178
sp|Q0SH84|LEPA_RHOJR Elongation factor 4 OS=Rhodococcus jostii (strain RHA1) GN=lepA PE=3 SV=1 54 648 4.0E-178
sp|Q63S94|LEPA_BURPS Elongation factor 4 OS=Burkholderia pseudomallei (strain K96243) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|A3NBT1|LEPA_BURP6 Elongation factor 4 OS=Burkholderia pseudomallei (strain 668) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|Q3JQ75|LEPA_BURP1 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1710b) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|A3NXL8|LEPA_BURP0 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1106a) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|A1V6B9|LEPA_BURMS Elongation factor 4 OS=Burkholderia mallei (strain SAVP1) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|Q62LT1|LEPA_BURMA Elongation factor 4 OS=Burkholderia mallei (strain ATCC 23344) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|A2S9Z3|LEPA_BURM9 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10229) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|A3MM44|LEPA_BURM7 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10247) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|Q1I5V6|LEPA_PSEE4 Elongation factor 4 OS=Pseudomonas entomophila (strain L48) GN=lepA PE=3 SV=1 52 647 4.0E-178
sp|B7KJX0|LEPA_CYAP7 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7424) GN=lepA PE=3 SV=1 50 647 5.0E-178
sp|B0KV29|LEPA_PSEPG Elongation factor 4 OS=Pseudomonas putida (strain GB-1) GN=lepA PE=3 SV=1 52 647 6.0E-178
sp|Q9ZDQ1|LEPA_RICPR Elongation factor 4 OS=Rickettsia prowazekii (strain Madrid E) GN=lepA PE=3 SV=1 55 643 7.0E-178
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 52 643 7.0E-178
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 53 647 7.0E-178
sp|Q12KH9|LEPA_SHEDO Elongation factor 4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lepA PE=3 SV=1 52 647 8.0E-178
sp|A9RFQ5|GUFP_PHYPA Translation factor GUF1 homolog, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_158777 PE=3 SV=1 21 647 9.0E-178
sp|Q5PAX8|LEPA_ANAMM Elongation factor 4 OS=Anaplasma marginale (strain St. Maries) GN=lepA PE=3 SV=1 55 643 9.0E-178
sp|B9KIE5|LEPA_ANAMF Elongation factor 4 OS=Anaplasma marginale (strain Florida) GN=lepA PE=3 SV=1 55 643 9.0E-178
sp|Q87XF8|LEPA_PSESM Elongation factor 4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lepA PE=3 SV=1 52 647 9.0E-178
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 54 647 1.0E-177
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 52 647 1.0E-177
sp|B3CPV1|LEPA_WOLPP Elongation factor 4 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lepA PE=3 SV=1 52 643 1.0E-177
sp|C1AUN7|LEPA_RHOOB Elongation factor 4 OS=Rhodococcus opacus (strain B4) GN=lepA PE=3 SV=1 54 648 1.0E-177
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 50 647 2.0E-177
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 53 648 2.0E-177
sp|Q1QX26|LEPA_CHRSD Elongation factor 4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lepA PE=3 SV=1 44 647 2.0E-177
sp|C3K6G8|LEPA_PSEFS Elongation factor 4 OS=Pseudomonas fluorescens (strain SBW25) GN=lepA PE=3 SV=1 52 647 2.0E-177
sp|Q49Y26|LEPA_STAS1 Elongation factor 4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lepA PE=3 SV=1 53 647 2.0E-177
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 52 647 3.0E-177
sp|Q3KHM1|LEPA_PSEPF Elongation factor 4 OS=Pseudomonas fluorescens (strain Pf0-1) GN=lepA PE=3 SV=1 52 647 3.0E-177
sp|A8GW16|LEPA_RICB8 Elongation factor 4 OS=Rickettsia bellii (strain OSU 85-389) GN=lepA PE=3 SV=1 55 643 3.0E-177
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 53 648 4.0E-177
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 53 648 4.0E-177
sp|Q5LUS0|LEPA_RUEPO Elongation factor 4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lepA PE=3 SV=1 52 643 4.0E-177
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 53 648 5.0E-177
sp|Q0C5X0|LEPA_HYPNA Elongation factor 4 OS=Hyphomonas neptunium (strain ATCC 15444) GN=lepA PE=3 SV=1 51 643 5.0E-177
sp|A1S3X9|LEPA_SHEAM Elongation factor 4 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lepA PE=3 SV=1 52 647 6.0E-177
sp|Q1B684|LEPA_MYCSS Elongation factor 4 OS=Mycobacterium sp. (strain MCS) GN=lepA PE=3 SV=1 23 648 6.0E-177
sp|A1UIU2|LEPA_MYCSK Elongation factor 4 OS=Mycobacterium sp. (strain KMS) GN=lepA PE=3 SV=1 23 648 6.0E-177
sp|A3Q2A6|LEPA_MYCSJ Elongation factor 4 OS=Mycobacterium sp. (strain JLS) GN=lepA PE=3 SV=1 23 648 6.0E-177
sp|B2JFK0|LEPA_BURP8 Elongation factor 4 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lepA PE=3 SV=1 52 647 6.0E-177
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 55 643 7.0E-177
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 53 647 7.0E-177
sp|B1J4D8|LEPA_PSEPW Elongation factor 4 OS=Pseudomonas putida (strain W619) GN=lepA PE=3 SV=1 52 647 8.0E-177
sp|A1K601|LEPA_AZOSB Elongation factor 4 OS=Azoarcus sp. (strain BH72) GN=lepA PE=3 SV=1 52 647 8.0E-177
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 52 647 9.0E-177
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 53 648 9.0E-177
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 53 648 9.0E-177
sp|Q4KHT3|LEPA_PSEF5 Elongation factor 4 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lepA PE=3 SV=2 52 647 1.0E-176
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 53 647 1.0E-176
sp|Q9I5G8|LEPA_PSEAE Elongation factor 4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lepA PE=3 SV=1 52 647 1.0E-176
sp|Q02HR9|LEPA_PSEAB Elongation factor 4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lepA PE=3 SV=1 52 647 1.0E-176
sp|B7UYX5|LEPA_PSEA8 Elongation factor 4 OS=Pseudomonas aeruginosa (strain LESB58) GN=lepA PE=3 SV=1 52 647 1.0E-176
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 55 643 1.0E-176
sp|Q8Y0I4|LEPA_RALSO Elongation factor 4 OS=Ralstonia solanacearum (strain GMI1000) GN=lepA PE=3 SV=1 52 647 1.0E-176
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 53 648 2.0E-176
sp|A8GRF6|LEPA_RICRS Elongation factor 4 OS=Rickettsia rickettsii (strain Sheila Smith) GN=lepA PE=3 SV=1 55 643 2.0E-176
sp|B0BWV5|LEPA_RICRO Elongation factor 4 OS=Rickettsia rickettsii (strain Iowa) GN=lepA PE=3 SV=1 55 643 2.0E-176
sp|A6VAK9|LEPA_PSEA7 Elongation factor 4 OS=Pseudomonas aeruginosa (strain PA7) GN=lepA PE=3 SV=1 52 647 2.0E-176
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 53 647 2.0E-176
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 53 648 2.0E-176
sp|A8H1C5|LEPA_SHEPA Elongation factor 4 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lepA PE=3 SV=1 52 647 2.0E-176
sp|B9F2U5|GUFP_ORYSJ Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0157700 PE=3 SV=1 44 647 2.0E-176
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 54 647 2.0E-176
sp|B9DNK4|LEPA_STACT Elongation factor 4 OS=Staphylococcus carnosus (strain TM300) GN=lepA PE=3 SV=1 53 647 2.0E-176
sp|A9HG78|LEPA_GLUDA Elongation factor 4 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=lepA PE=3 SV=1 51 647 2.0E-176
sp|Q48EV0|LEPA_PSE14 Elongation factor 4 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lepA PE=3 SV=1 52 647 3.0E-176
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 52 647 3.0E-176
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 52 647 3.0E-176
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 54 648 3.0E-176
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 54 648 3.0E-176
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 52 647 4.0E-176
sp|Q2GGA6|LEPA_EHRCR Elongation factor 4 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lepA PE=3 SV=1 55 643 4.0E-176
sp|B4RVA8|LEPA_ALTMD Elongation factor 4 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lepA1 PE=3 SV=1 55 647 4.0E-176
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 54 647 5.0E-176
sp|Q6KHP1|LEPA_MYCMO Elongation factor 4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lepA PE=3 SV=1 54 647 5.0E-176
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 52 647 6.0E-176
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 53 648 6.0E-176
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 53 647 6.0E-176
sp|Q1H2L5|LEPA_METFK Elongation factor 4 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lepA1 PE=3 SV=1 52 647 7.0E-176
sp|Q2GD00|LEPA_NEOSM Elongation factor 4 OS=Neorickettsia sennetsu (strain Miyayama) GN=lepA PE=3 SV=1 52 643 7.0E-176
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 55 647 8.0E-176
sp|Q8GCP5|LEPA_MYCFP Elongation factor 4 OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lepA PE=3 SV=1 54 647 8.0E-176
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 51 643 8.0E-176
sp|C1DQS0|LEPA_AZOVD Elongation factor 4 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lepA PE=3 SV=1 52 647 8.0E-176
sp|Q4UKS2|LEPA_RICFE Elongation factor 4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lepA PE=3 SV=1 55 643 8.0E-176
sp|Q2G550|LEPA_NOVAD Elongation factor 4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lepA PE=3 SV=1 55 643 9.0E-176
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 47 643 9.0E-176
sp|A7IEG8|LEPA_XANP2 Elongation factor 4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lepA PE=3 SV=1 53 643 1.0E-175
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 50 647 1.0E-175
sp|Q8CP13|LEPA_STAES Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lepA PE=3 SV=1 53 647 2.0E-175
sp|Q5HNW2|LEPA_STAEQ Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lepA PE=3 SV=1 53 647 2.0E-175
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 52 647 2.0E-175
sp|A5IYS0|LEPA_MYCAP Elongation factor 4 OS=Mycoplasma agalactiae (strain PG2) GN=lepA PE=3 SV=1 54 647 2.0E-175
sp|A4VIX2|LEPA_PSEU5 Elongation factor 4 OS=Pseudomonas stutzeri (strain A1501) GN=lepA PE=3 SV=1 52 647 2.0E-175
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 55 643 3.0E-175
sp|Q4ZPD8|LEPA_PSEU2 Elongation factor 4 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lepA PE=3 SV=1 52 647 4.0E-175
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 52 647 5.0E-175
sp|Q1IV51|LEPA_KORVE Elongation factor 4 OS=Koribacter versatilis (strain Ellin345) GN=lepA PE=3 SV=1 55 647 5.0E-175
sp|C0R5S3|LEPA_WOLWR Elongation factor 4 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=lepA PE=3 SV=1 52 643 6.0E-175
sp|B1XK44|LEPA_SYNP2 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=lepA PE=3 SV=1 50 647 7.0E-175
sp|Q21IH3|LEPA_SACD2 Elongation factor 4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lepA PE=3 SV=1 52 647 8.0E-175
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 52 647 8.0E-175
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 53 647 9.0E-175
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 51 643 1.0E-174
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 51 643 1.0E-174
sp|Q73HR8|LEPA_WOLPM Elongation factor 4 OS=Wolbachia pipientis wMel GN=lepA PE=3 SV=1 52 643 1.0E-174
sp|Q1GRH5|LEPA_SPHAL Elongation factor 4 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lepA PE=3 SV=1 51 643 1.0E-174
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 54 647 1.0E-174
sp|A9BNJ8|LEPA_DELAS Elongation factor 4 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=lepA PE=3 SV=1 52 647 1.0E-174
sp|Q4AAQ8|LEPA_MYCHJ Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lepA PE=3 SV=1 53 647 2.0E-174
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 52 647 2.0E-174
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 50 647 2.0E-174
sp|Q9ZHZ8|LEPA_MYCH2 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 232) GN=lepA PE=3 SV=3 53 647 2.0E-174
sp|B1YKS5|LEPA_EXIS2 Elongation factor 4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=lepA PE=3 SV=1 55 648 2.0E-174
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 52 647 3.0E-174
sp|Q4FUV9|LEPA_PSYA2 Elongation factor 4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lepA PE=3 SV=1 52 647 3.0E-174
sp|B8AI54|GUFP_ORYSI Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_05919 PE=3 SV=1 56 647 3.0E-174
sp|P9WK97|LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lepA PE=1 SV=1 54 648 3.0E-174
sp|P9WK96|LEPA_MYCTO Elongation factor 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lepA PE=3 SV=1 54 648 3.0E-174
sp|A5U598|LEPA_MYCTA Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lepA PE=3 SV=1 54 648 3.0E-174
sp|C1AQW9|LEPA_MYCBT Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lepA PE=3 SV=1 54 648 3.0E-174
sp|A1KL96|LEPA_MYCBP Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lepA PE=3 SV=1 54 648 3.0E-174
sp|P65270|LEPA_MYCBO Elongation factor 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lepA PE=3 SV=1 54 648 3.0E-174
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 55 647 3.0E-174
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 55 647 3.0E-174
sp|A8EY28|LEPA_RICCK Elongation factor 4 OS=Rickettsia canadensis (strain McKiel) GN=lepA PE=3 SV=1 55 643 3.0E-174
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 55 647 3.0E-174
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 51 643 3.0E-174
sp|Q5NLP5|LEPA_ZYMMO Elongation factor 4 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lepA PE=3 SV=1 51 643 5.0E-174
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 55 647 7.0E-174
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 55 647 7.0E-174
sp|A5WCD6|LEPA_PSYWF Elongation factor 4 OS=Psychrobacter sp. (strain PRwf-1) GN=lepA PE=3 SV=1 52 647 7.0E-174
sp|Q4A8T9|LEPA_MYCH7 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 7448) GN=lepA PE=3 SV=1 53 647 8.0E-174
sp|A2SDH0|LEPA_METPP Elongation factor 4 OS=Methylibium petroleiphilum (strain PM1) GN=lepA PE=3 SV=1 52 647 9.0E-174
sp|Q8F500|LEPA_LEPIN Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lepA PE=3 SV=1 55 647 9.0E-174
sp|Q72QU8|LEPA_LEPIC Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lepA PE=3 SV=1 55 647 9.0E-174
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 54 648 9.0E-174
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 51 643 1.0E-173
sp|B0TIV5|LEPA_SHEHH Elongation factor 4 OS=Shewanella halifaxensis (strain HAW-EB4) GN=lepA PE=3 SV=1 52 647 1.0E-173
sp|A5B4D2|GUFP_VITVI Translation factor GUF1 homolog, chloroplastic OS=Vitis vinifera GN=VITISV_013255 PE=3 SV=1 35 647 2.0E-173
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 52 647 2.0E-173
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 52 647 3.0E-173
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 52 647 3.0E-173
sp|B9RHQ5|GUFP_RICCO Translation factor GUF1 homolog, chloroplastic OS=Ricinus communis GN=RCOM_1767360 PE=3 SV=1 44 647 3.0E-173
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 52 647 3.0E-173
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 52 647 3.0E-173
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 52 647 4.0E-173
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 52 647 4.0E-173
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 52 647 4.0E-173
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 52 647 4.0E-173
sp|A8GMT1|LEPA_RICAH Elongation factor 4 OS=Rickettsia akari (strain Hartford) GN=lepA PE=3 SV=1 55 643 5.0E-173
sp|B2U978|LEPA_RALPJ Elongation factor 4 OS=Ralstonia pickettii (strain 12J) GN=lepA PE=3 SV=1 52 647 6.0E-173
sp|A5CE57|LEPA_ORITB Elongation factor 4 OS=Orientia tsutsugamushi (strain Boryong) GN=lepA PE=3 SV=1 55 643 6.0E-173
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 54 647 7.0E-173
sp|Q1AVV0|LEPA_RUBXD Elongation factor 4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lepA PE=3 SV=1 46 643 7.0E-173
sp|Q47RQ0|LEPA_THEFY Elongation factor 4 OS=Thermobifida fusca (strain YX) GN=lepA PE=3 SV=1 55 648 8.0E-173
sp|C5CSF2|LEPA_VARPS Elongation factor 4 OS=Variovorax paradoxus (strain S110) GN=lepA PE=3 SV=1 52 647 1.0E-172
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 50 647 1.0E-172
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 55 648 1.0E-172
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 50 647 1.0E-172
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 52 647 1.0E-172
sp|B1I6E0|LEPA_DESAP Elongation factor 4 OS=Desulforudis audaxviator (strain MP104C) GN=lepA PE=3 SV=1 50 648 2.0E-172
sp|Q126K0|LEPA_POLSJ Elongation factor 4 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=lepA PE=3 SV=1 52 647 2.0E-172
sp|Q8EWZ9|LEPA_MYCPE Elongation factor 4 OS=Mycoplasma penetrans (strain HF-2) GN=lepA PE=3 SV=1 55 649 2.0E-172
sp|Q64T74|LEPA_BACFR Elongation factor 4 OS=Bacteroides fragilis (strain YCH46) GN=lepA PE=3 SV=1 52 647 2.0E-172
sp|Q5LC85|LEPA_BACFN Elongation factor 4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lepA PE=3 SV=1 52 647 2.0E-172
sp|Q98QW3|LEPA_MYCPU Elongation factor 4 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lepA PE=3 SV=2 54 647 2.0E-172
sp|B3CRQ1|LEPA_ORITI Elongation factor 4 OS=Orientia tsutsugamushi (strain Ikeda) GN=lepA PE=3 SV=1 55 643 2.0E-172
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 55 648 3.0E-172
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 55 647 3.0E-172
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 52 647 3.0E-172
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 55 647 4.0E-172
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 52 647 5.0E-172
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 51 647 5.0E-172
sp|A1VRT5|LEPA_POLNA Elongation factor 4 OS=Polaromonas naphthalenivorans (strain CJ2) GN=lepA PE=3 SV=1 52 647 5.0E-172
sp|B1JRC5|LEPA_YERPY Elongation factor 4 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lepA PE=3 SV=1 52 647 5.0E-172
sp|Q667U9|LEPA_YERPS Elongation factor 4 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lepA PE=3 SV=1 52 647 5.0E-172
sp|Q1CKE6|LEPA_YERPN Elongation factor 4 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lepA PE=3 SV=1 52 647 5.0E-172
sp|A9R400|LEPA_YERPG Elongation factor 4 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lepA PE=3 SV=1 52 647 5.0E-172
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5428
MNWAWRSGWRAWTRTLPVLEPRLSARPPRGIRAYSAKPTPKDLEQRIAAIPIERFRNFCIVAHIDHGKSTLSDRL
LELTGTISASDANKQILDKLDVERERGITVKAQTCTMLYNHKGEDYLLHLVDTPGHVDFRAEVMRSYASCGGALL
LVDASQGIQAQTVSNFHLAFAEDLALVPVINKIDMMSADIPRVLEQIETSFELNPKDAVMVSAKTGKGVPEILPV
VVERMPPPEGDEKKPLKMLLVDSWYDNFKGVGLLVRVFDGAVKAGDQVVSLGTGSRYTVGQVGIQYPDATVQNVL
RAGQVGFIFFNPAVKRIQEAKLGDTYTTVAHETAVTPCPGFTEPKPMVFVAAFPADTTDYGRLADSIGQLALNDR
SVTVAKDFSEALGSGWRLGFLGSLHCSVFQDRLKQEHGRSLILTEPTVPSKLVWSDGREEVVTNPALFPDSERRS
SLKTFEPYVKATVTVPQEHLGRIIEICEANRGEQVSLEYYGNQVILVYDMPTAHLVDDLFGKLKSASKGYATLEY
EDDGWRESSLVKLQLLLNRVPVDAVCRVLHESQAERLARHWVTKFREHVDRQMFEVVIQAAVGNKILARETIKPF
RKDVLAKLHAADASRRRKLLEKQKEGRKRLQQVGNVSIDQAAFQGFLSK*
Coding >OphauB2|5428
ATGAACTGGGCCTGGAGAAGCGGTTGGCGGGCATGGACTCGAACATTGCCAGTGTTGGAGCCCAGGCTTAGTGCT
CGACCGCCACGAGGCATTCGAGCCTATTCAGCCAAACCGACGCCCAAGGACCTCGAACAAAGAATTGCAGCTATT
CCAATTGAGCGATTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTCGAGCTAACGGGCACGATATCTGCCAGCGATGCAAACAAGCAAATTCTCGACAAGCTCGATGTTGAGCGGGAA
CGCGGCATCACGGTCAAGGCGCAGACTTGCACCATGCTCTACAACCACAAGGGCGAGGACTACCTATTGCACCTT
GTCGATACGCCGGGCCACGTCGATTTCCGTGCCGAGGTGATGCGATCGTATGCCAGCTGCGGTGGCGCGCTGCTG
CTGGTTGACGCCAGCCAGGGCATCCAGGCGCAGACGGTGTCGAATTTCCATCTTGCCTTTGCCGAGGATCTGGCT
CTGGTGCCTGTCATCAATAAAATCGACATGATGTCTGCAGATATTCCGCGCGTGCTGGAGCAGATTGAGACGTCG
TTTGAGCTCAACCCCAAGGATGCGGTCATGGTGAGCGCCAAGACGGGCAAAGGCGTGCCCGAGATATTACCCGTG
GTGGTGGAGCGGATGCCTCCTCCTGAGGGCGACGAGAAGAAGCCACTCAAGATGTTGCTGGTGGACTCGTGGTAC
GACAACTTTAAAGGCGTGGGCCTTTTGGTGCGAGTCTTTGACGGCGCAGTCAAGGCGGGAGACCAAGTCGTTTCG
CTCGGCACCGGCTCGCGCTACACAGTCGGGCAGGTTGGCATCCAATATCCCGACGCGACTGTCCAAAACGTGCTG
CGTGCAGGCCAAGTCGGCTTCATATTTTTCAACCCCGCCGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACA
TACACCACTGTAGCACACGAGACGGCTGTGACGCCGTGCCCAGGCTTCACAGAGCCCAAGCCCATGGTGTTTGTG
GCTGCCTTTCCCGCCGACACGACCGACTATGGGCGGCTGGCTGACAGCATTGGCCAACTGGCGCTCAACGACCGC
AGCGTCACCGTGGCCAAGGATTTCTCCGAGGCACTGGGATCAGGATGGCGGCTCGGCTTCCTCGGCAGCTTGCAC
TGCTCCGTCTTCCAGGACCGGCTCAAGCAGGAGCACGGCCGCAGCCTCATCCTGACGGAGCCAACGGTGCCGTCA
AAGCTTGTGTGGAGCGACGGGAGAGAAGAAGTGGTGACGAATCCAGCCCTCTTTCCCGACAGCGAGAGGCGGTCG
AGCCTCAAGACTTTTGAGCCATATGTCAAGGCTACGGTTACCGTGCCTCAGGAGCACTTGGGGCGGATAATTGAG
ATTTGCGAGGCTAATCGCGGAGAGCAAGTTAGCCTCGAGTATTACGGGAACCAAGTCATTTTGGTATACGACATG
CCGACGGCGCATCTTGTCGACGACTTGTTTGGCAAACTCAAGAGCGCAAGCAAGGGATATGCGACCCTCGAATAC
GAAGATGATGGGTGGCGAGAAAGCTCGCTGGTGAAGCTGCAGCTGCTACTGAACCGGGTACCCGTGGATGCGGTG
TGTCGCGTCTTGCACGAGTCGCAGGCTGAGCGCTTGGCGAGACATTGGGTGACCAAGTTTAGAGAGCATGTTGAT
CGACAAATGTTTGAGGTTGTCATCCAAGCAGCCGTGGGCAACAAGATTCTGGCGCGCGAGACGATTAAGCCCTTT
CGCAAGGACGTGCTGGCCAAGCTGCACGCTGCTGATGCGTCGCGGCGGCGCAAGCTGCTGGAGAAGCAAAAGGAA
GGGCGGAAGCGGCTGCAGCAGGTGGGCAATGTCTCGATTGACCAGGCGGCGTTTCAGGGCTTCTTGTCCAAGTAG
Transcript >OphauB2|5428
ATGAACTGGGCCTGGAGAAGCGGTTGGCGGGCATGGACTCGAACATTGCCAGTGTTGGAGCCCAGGCTTAGTGCT
CGACCGCCACGAGGCATTCGAGCCTATTCAGCCAAACCGACGCCCAAGGACCTCGAACAAAGAATTGCAGCTATT
CCAATTGAGCGATTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTCGAGCTAACGGGCACGATATCTGCCAGCGATGCAAACAAGCAAATTCTCGACAAGCTCGATGTTGAGCGGGAA
CGCGGCATCACGGTCAAGGCGCAGACTTGCACCATGCTCTACAACCACAAGGGCGAGGACTACCTATTGCACCTT
GTCGATACGCCGGGCCACGTCGATTTCCGTGCCGAGGTGATGCGATCGTATGCCAGCTGCGGTGGCGCGCTGCTG
CTGGTTGACGCCAGCCAGGGCATCCAGGCGCAGACGGTGTCGAATTTCCATCTTGCCTTTGCCGAGGATCTGGCT
CTGGTGCCTGTCATCAATAAAATCGACATGATGTCTGCAGATATTCCGCGCGTGCTGGAGCAGATTGAGACGTCG
TTTGAGCTCAACCCCAAGGATGCGGTCATGGTGAGCGCCAAGACGGGCAAAGGCGTGCCCGAGATATTACCCGTG
GTGGTGGAGCGGATGCCTCCTCCTGAGGGCGACGAGAAGAAGCCACTCAAGATGTTGCTGGTGGACTCGTGGTAC
GACAACTTTAAAGGCGTGGGCCTTTTGGTGCGAGTCTTTGACGGCGCAGTCAAGGCGGGAGACCAAGTCGTTTCG
CTCGGCACCGGCTCGCGCTACACAGTCGGGCAGGTTGGCATCCAATATCCCGACGCGACTGTCCAAAACGTGCTG
CGTGCAGGCCAAGTCGGCTTCATATTTTTCAACCCCGCCGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACA
TACACCACTGTAGCACACGAGACGGCTGTGACGCCGTGCCCAGGCTTCACAGAGCCCAAGCCCATGGTGTTTGTG
GCTGCCTTTCCCGCCGACACGACCGACTATGGGCGGCTGGCTGACAGCATTGGCCAACTGGCGCTCAACGACCGC
AGCGTCACCGTGGCCAAGGATTTCTCCGAGGCACTGGGATCAGGATGGCGGCTCGGCTTCCTCGGCAGCTTGCAC
TGCTCCGTCTTCCAGGACCGGCTCAAGCAGGAGCACGGCCGCAGCCTCATCCTGACGGAGCCAACGGTGCCGTCA
AAGCTTGTGTGGAGCGACGGGAGAGAAGAAGTGGTGACGAATCCAGCCCTCTTTCCCGACAGCGAGAGGCGGTCG
AGCCTCAAGACTTTTGAGCCATATGTCAAGGCTACGGTTACCGTGCCTCAGGAGCACTTGGGGCGGATAATTGAG
ATTTGCGAGGCTAATCGCGGAGAGCAAGTTAGCCTCGAGTATTACGGGAACCAAGTCATTTTGGTATACGACATG
CCGACGGCGCATCTTGTCGACGACTTGTTTGGCAAACTCAAGAGCGCAAGCAAGGGATATGCGACCCTCGAATAC
GAAGATGATGGGTGGCGAGAAAGCTCGCTGGTGAAGCTGCAGCTGCTACTGAACCGGGTACCCGTGGATGCGGTG
TGTCGCGTCTTGCACGAGTCGCAGGCTGAGCGCTTGGCGAGACATTGGGTGACCAAGTTTAGAGAGCATGTTGAT
CGACAAATGTTTGAGGTTGTCATCCAAGCAGCCGTGGGCAACAAGATTCTGGCGCGCGAGACGATTAAGCCCTTT
CGCAAGGACGTGCTGGCCAAGCTGCACGCTGCTGATGCGTCGCGGCGGCGCAAGCTGCTGGAGAAGCAAAAGGAA
GGGCGGAAGCGGCTGCAGCAGGTGGGCAATGTCTCGATTGACCAGGCGGCGTTTCAGGGCTTCTTGTCCAAGTAG
Gene >OphauB2|5428
ATGAACTGGGCCTGGAGAAGCGGTTGGCGGGCATGGACTCGAACATTGCCAGTGTTGGAGCCCAGGCTTAGTGCT
CGACCGCCACGAGGCATTCGAGCCTATTCAGCCAAACCGACGCCCAAGGACCTCGAACAAAGAATTGCAGCTATT
CCAATTGAGCGATTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTCGAGCTAACGGGCACGATATCTGCCAGCGATGCAAACAAGCAAATTCTCGTACGTCTTTTCAGAGTTTTGCCA
ACATGCTTTGCTCGGTCATGCAAAAAGGAAAAAAAATAAAATAAAATAAAAGCCCCAAAGGGAGCCAGACTGATG
CAATGCACTTTAGGACAAGCTCGATGTTGAGCGGGAACGCGGCATCACGGTCAAGGCGCAGACTTGCACCATGCT
CTACAACCACAAGGGCGAGGACTACCTATTGCACCTTGTCGATACGCCGGGCCACGTCGATTTCCGTGCCGAGGT
GATGCGATCGTATGCCAGCTGCGGTGGCGCGCTGCTGCTGGTTGACGCCAGCCAGGGCATCCAGGCGCAGACGGT
GTCGAATTTCCATCTTGCCTTTGCCGAGGATCTGGCTCTGGTGCCTGTCATCAATAAAATCGACATGATGTCTGC
AGATATTCCGCGCGTGCTGGAGCAGATTGAGACGTCGTTTGAGCTCAACCCCAAGGATGCGGTCATGGTGAGCGC
CAAGACGGGCAAAGGCGTGCCCGAGATATTACCCGTGGTGGTGGAGCGGATGCCTCCTCCTGAGGGCGACGAGAA
GAAGCCACTCAAGATGTTGCTGGTGGACTCGTGGTACGACAACTTTAAAGGCGTGGGCCTTTTGGTGCGAGTCTT
TGACGGCGCAGTCAAGGCGGGAGACCAAGTCGTTTCGCTCGGCACCGGCTCGCGCTACACAGTCGGGCAGGTTGG
CATCCAATATCCCGACGCGACTGTCCAAAACGTGCTGCGTGCAGGCCAAGTCGGCTTCATATTTTTCAACCCCGC
CGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACATACACCACTGTAGCACACGAGACGGCTGTGACGCCGTG
CCCAGGCTTCACAGAGCCCAAGCCCATGGTGTTTGTGGCTGCCTTTCCCGCCGACACGACCGACTATGGGCGGCT
GGCTGACAGCATTGGCCAACTGGCGCTCAACGACCGCAGCGTCACCGTGGCCAAGGATTTCTCCGAGGCACTGGG
ATCAGGATGGCGGCTCGGCTTCCTCGGCAGCTTGCACTGCTCCGTCTTCCAGGACCGGCTCAAGCAGGAGCACGG
CCGCAGCCTCATCCTGACGGAGCCAACGGTGCCGTCAAAGCTTGTGTGGAGCGACGGGAGAGAAGAAGTGGTGAC
GAATCCAGCCCTCTTTCCCGACAGCGAGAGGCGGTCGAGCCTCAAGACTTTTGAGCCGTGGGTTGTGCCCTTTTA
TTTTGAGTTTTTTTTTTTTTTTCAAGCAAGGGATTTGGAATGCTGATGCAAAGCGAAAAAAAAACAGATATGTCA
AGGCTACGGTTACCGTGCCTCAGGAGCACTTGGGGCGGATAATTGAGATTTGCGAGGCTAATCGCGGAGAGCAAG
TTAGCCTCGAGTATTACGGGAACCAAGTCATTTTGGTATACGACATGCCGACGGCGCATCTTGTCGACGACTTGT
TTGGCAAACTCAAGAGCGCAAGGTGAGGAGCACTATGCTTTTTTTTTTTTTTTCCCATGCTTTCTTTTGAGTGGA
GGAGAGAGGAGTTATATATTTGGCGACGAGTTCACGGCGACAGATGCTGACAGTGAGGAAATAGCAAGGGATATG
CGACCCTCGAATACGAAGATGATGGGTGGCGAGAAAGCTCGCTGGTGAAGCTGCAGCTGCTACTGAACCGGGTAC
CCGTGGATGCGGTGTGTCGCGTCTTGCACGAGTCGCAGGCTGAGCGCTTGGCGAGACATTGGGTGACCAAGTTTA
GAGAGCATGTTGATCGACAAATGTTTGGTATGTTTTTTTTTTTTTTTTTTTTTTTTTTCACAACGCCCCATGGGT
AAACCGAGTCCAAGATGTTTAGCAACAGATGAAGAGGAAAAAGGGGGCAAGATGAGCAAGGGGATAAGAGACGAG
ATGAAGAAGACATTTAAAAAGAGACGCTAGAGAGGGCTCAGCTAACTGGCACGTTTCTTTTCTACAGAGGTTGTC
ATCCAAGCAGCCGTGGGCAACAAGATTCTGGCGCGCGAGACGATTAAGCCCTTTCGCAAGGACGTGCTGGCCAAG
CTGCACGCTGCTGATGCGTCGCGGCGGCGCAAGCTGCTGGAGAAGCAAAAGGAAGGGCGGAAGCGGCTGCAGCAG
GTGGGCAATGTCTCGATTGACCAGGCGGCGTTTCAGGGCTTCTTGTCCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail