Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5425
Gene name
LocationContig_41:120860..122300
Strand-
Gene length (bp)1440
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02586 SRAP SOS response associated peptidase (SRAP) 2.2E-77 1 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04471|YM04_YEAST Putative peptidase YMR114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR114C PE=1 SV=1 1 385 8.0E-42
sp|Q5ZJT1|HMCES_CHICK Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Gallus gallus GN=HMCES PE=2 SV=1 1 275 9.0E-30
sp|Q6P7N4|HMCES_XENTR Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus tropicalis GN=hmces PE=2 SV=1 1 264 1.0E-25
sp|O64131|YOQW_BPSPB Putative SOS response-associated peptidase yoqW OS=Bacillus phage SPbeta GN=yoqW PE=3 SV=1 85 261 2.0E-25
sp|O31916|YOQW_BACSU Putative SOS response-associated peptidase YoqW OS=Bacillus subtilis (strain 168) GN=yoqW PE=3 SV=1 85 261 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04471|YM04_YEAST Putative peptidase YMR114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR114C PE=1 SV=1 1 385 8.0E-42
sp|Q5ZJT1|HMCES_CHICK Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Gallus gallus GN=HMCES PE=2 SV=1 1 275 9.0E-30
sp|Q6P7N4|HMCES_XENTR Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus tropicalis GN=hmces PE=2 SV=1 1 264 1.0E-25
sp|O64131|YOQW_BPSPB Putative SOS response-associated peptidase yoqW OS=Bacillus phage SPbeta GN=yoqW PE=3 SV=1 85 261 2.0E-25
sp|O31916|YOQW_BACSU Putative SOS response-associated peptidase YoqW OS=Bacillus subtilis (strain 168) GN=yoqW PE=3 SV=1 85 261 2.0E-25
sp|Q6IND6|HMCES_XENLA Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus laevis GN=hmces PE=2 SV=1 1 306 2.0E-24
sp|Q5NVR0|HMCES_PONAB Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Pongo abelii GN=HMCES PE=2 SV=1 80 272 1.0E-22
sp|Q96FZ2|HMCES_HUMAN Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Homo sapiens GN=HMCES PE=1 SV=1 1 265 2.0E-22
sp|O34906|YOAM_BACSU Putative SOS response-associated peptidase YoaM OS=Bacillus subtilis (strain 168) GN=yoaM PE=3 SV=1 85 261 1.0E-21
sp|Q5XIJ1|HMCES_RAT Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Rattus norvegicus GN=Hmces PE=2 SV=1 1 272 4.0E-21
sp|Q8R1M0|HMCES_MOUSE Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Mus musculus GN=Hmces PE=1 SV=1 89 272 6.0E-21
sp|O34915|YOBE_BACSU Putative SOS response-associated peptidase YobE OS=Bacillus subtilis (strain 168) GN=yobE PE=3 SV=1 85 250 4.0E-20
sp|P76318|YEDK_ECOLI Putative SOS response-associated peptidase YedK OS=Escherichia coli (strain K12) GN=yedK PE=1 SV=2 1 264 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003697 single-stranded DNA binding Yes
GO:0018142 protein-DNA covalent cross-linking Yes
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006950 response to stress No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0033554 cellular response to stress No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0018143 nucleic acid-protein covalent cross-linking No
GO:0051716 cellular response to stimulus No
GO:0003677 DNA binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4996
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4552
Ophiocordyceps australis map64 (Brazil) OphauB2|5425 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02495
Ophiocordyceps kimflemingae Ophio5|2674
Ophiocordyceps subramaniannii Hirsu2|2344

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5425
MCGRYALALPPSQVRHALADYDLPINDAPPDHGPDAPRLAFNFAPGYHGLVYRANVADCGAGPAPTRQDDNQDTS
DSCCADATYKLQAMKWGLIPFWTKRNPDYASLLRTINCRDDSLASPGGMWSAIKARKRCIVVAQGFYEWLRLGPR
EKVPHYVKRRDGRLLCLAGLWDCVQYQDSSHKIYSYTIITTSSNKQLSFLHDRMPVILDASAIHTWLDPALHTWS
SQLQSLLRPYPHPNALDVYPVSKDVGKVGNQSPSFIVPVNSKENKANIANFFEKARNNDKHEEKHTKIKGTRHSE
PSLGVPEGSNTTHNVKSNSKDTEIHEEKDIKNKQESESSLPAPQSKNLHSSSKRKTPPATPKSSPFKKISATHSQ
HPSPAKTKAKGSQKITNFFNHKS*
Coding >OphauB2|5425
ATGTGTGGACGATATGCCTTGGCACTGCCTCCCTCGCAGGTCCGCCACGCCCTTGCCGACTACGACTTGCCCATC
AATGACGCTCCTCCAGACCATGGACCCGACGCGCCCCGTCTGGCATTCAACTTTGCCCCCGGCTACCACGGCCTC
GTCTACCGCGCCAACGTTGCAGACTGCGGCGCCGGCCCTGCTCCCACCCGCCAAGACGACAATCAAGACACGAGT
GACTCTTGTTGCGCAGATGCAACGTATAAACTCCAAGCCATGAAATGGGGCCTCATTCCCTTTTGGACAAAGCGG
AACCCAGACTATGCGTCTCTGCTGCGCACGATTAACTGTCGAGACGACTCACTCGCCTCGCCGGGTGGCATGTGG
AGCGCCATCAAGGCTCGCAAGCGCTGCATTGTCGTTGCTCAGGGCTTTTATGAGTGGTTGCGCCTTGGGCCGCGA
GAAAAGGTTCCCCACTATGTTAAGCGTCGCGACGGCCGTCTTTTATGCCTTGCCGGGCTGTGGGACTGCGTACAG
TATCAAGACTCGTCTCATAAAATTTATTCCTACACCATCATCACCACCTCTTCCAACAAGCAACTCTCCTTTCTC
CACGACCGCATGCCCGTCATTCTCGACGCCTCAGCCATTCACACTTGGCTGGACCCCGCTCTACACACGTGGTCC
TCGCAACTACAGAGTCTTCTCCGCCCCTATCCTCACCCCAATGCCCTTGATGTATACCCCGTCTCCAAGGACGTG
GGCAAAGTAGGCAACCAATCACCCTCCTTTATCGTGCCCGTCAATAGCAAGGAAAACAAGGCAAATATTGCAAAC
TTTTTTGAAAAGGCGCGCAACAATGACAAGCACGAGGAAAAGCACACCAAGATTAAAGGTACAAGGCATTCCGAG
CCAAGTCTTGGTGTGCCCGAGGGCTCAAACACGACCCATAATGTCAAGTCGAATTCCAAAGACACAGAAATCCAC
GAGGAAAAAGACATCAAGAACAAACAAGAGTCGGAATCGTCTCTACCTGCACCGCAAAGCAAAAACCTACACTCT
TCTTCCAAGCGCAAAACACCTCCAGCCACCCCAAAGAGCTCACCTTTCAAAAAGATTAGCGCAACACATAGCCAA
CACCCTTCACCCGCCAAGACCAAAGCCAAGGGCTCGCAAAAGATTACAAACTTTTTTAACCACAAGTCTTGA
Transcript >OphauB2|5425
ATGTGTGGACGATATGCCTTGGCACTGCCTCCCTCGCAGGTCCGCCACGCCCTTGCCGACTACGACTTGCCCATC
AATGACGCTCCTCCAGACCATGGACCCGACGCGCCCCGTCTGGCATTCAACTTTGCCCCCGGCTACCACGGCCTC
GTCTACCGCGCCAACGTTGCAGACTGCGGCGCCGGCCCTGCTCCCACCCGCCAAGACGACAATCAAGACACGAGT
GACTCTTGTTGCGCAGATGCAACGTATAAACTCCAAGCCATGAAATGGGGCCTCATTCCCTTTTGGACAAAGCGG
AACCCAGACTATGCGTCTCTGCTGCGCACGATTAACTGTCGAGACGACTCACTCGCCTCGCCGGGTGGCATGTGG
AGCGCCATCAAGGCTCGCAAGCGCTGCATTGTCGTTGCTCAGGGCTTTTATGAGTGGTTGCGCCTTGGGCCGCGA
GAAAAGGTTCCCCACTATGTTAAGCGTCGCGACGGCCGTCTTTTATGCCTTGCCGGGCTGTGGGACTGCGTACAG
TATCAAGACTCGTCTCATAAAATTTATTCCTACACCATCATCACCACCTCTTCCAACAAGCAACTCTCCTTTCTC
CACGACCGCATGCCCGTCATTCTCGACGCCTCAGCCATTCACACTTGGCTGGACCCCGCTCTACACACGTGGTCC
TCGCAACTACAGAGTCTTCTCCGCCCCTATCCTCACCCCAATGCCCTTGATGTATACCCCGTCTCCAAGGACGTG
GGCAAAGTAGGCAACCAATCACCCTCCTTTATCGTGCCCGTCAATAGCAAGGAAAACAAGGCAAATATTGCAAAC
TTTTTTGAAAAGGCGCGCAACAATGACAAGCACGAGGAAAAGCACACCAAGATTAAAGGTACAAGGCATTCCGAG
CCAAGTCTTGGTGTGCCCGAGGGCTCAAACACGACCCATAATGTCAAGTCGAATTCCAAAGACACAGAAATCCAC
GAGGAAAAAGACATCAAGAACAAACAAGAGTCGGAATCGTCTCTACCTGCACCGCAAAGCAAAAACCTACACTCT
TCTTCCAAGCGCAAAACACCTCCAGCCACCCCAAAGAGCTCACCTTTCAAAAAGATTAGCGCAACACATAGCCAA
CACCCTTCACCCGCCAAGACCAAAGCCAAGGGCTCGCAAAAGATTACAAACTTTTTTAACCACAAGTCTTGA
Gene >OphauB2|5425
ATGTGTGGACGATATGCCTTGGCACTGGTATGTCTTCTTCTCCTTCACTCGTGTTGCAAATAACCCTCGACTGAT
TCACGCATCCAGCCTCCCTCGCAGGTCCGCCACGCCCTTGCCGACTACGACTTGCCCATCAATGACGCTCCTCCA
GACCATGGACCCGACGCGCCCCGTCTGGCATTCAACTTTGCCCCCGGCTACCACGGCCTCGTCTACCGCGCCAAC
GTTGCAGACTGCGGCGCCGGCCCTGCTCCCACCCGCCAAGACGACAATCAAGACACGAGTGACTCTTGTTGCGCA
GATGCAACGTATAAACTCCAAGCCATGAAATGGGGCCTCATTCCCTTTTGGACAAAGCGGAACCCAGACTATGCG
TCTCTGCTGCGCACGATTAACTGTCGAGACGACTCACTCGCCTCGCCGGGTGGCATGTGGAGCGCCATCAAGGCT
CGCAAGCGCTGCATTGTCGTTGCTCAGGGCTTTTATGAGTGGTTGCGCCTTGGGCCGCGAGAAAAGGTTCCCCAC
TATGTTAAGCGTCGCGACGGCCGTCTTTTATGCCTTGCCGGGCTGTGGGACTGCGTACAGTATCAAGGTAAACGC
CCTTTTTTTTTTTTTTTTTTTTTACAAAGTCTACGCCATGCTTTATAAACAAGGAAAAAGGCCCAACTGTTTTTT
TACCACGTCTACGCCATGCTCTGTAAACAAGGAAAAAAAAACTCTTTTATCCAAATCCAAAACTCGAGCCCATGC
ACAAAGACTGCAACTAACATGGCAGACTCGTCTCATAAAATTTATTCCTACACCATCATCACCACCTCTTCCAAC
AAGCAACTCTCCTTTCTCCACGACCGCATGCCCGTCATTCTCGACGCCTCAGCCATTCACACTTGGCTGGACCCC
GCTCTACACACGTGGTCCTCGCAACTACAGAGTCTTCTCCGCCCCTATCCTCACCCCAATGCCCTTGATGTATAC
CCCGTCTCCAAGGACGTGGGCAAAGTAGGCAACCAATCACCCTCCTTTATCGTGCCCGTCAATAGCAAGGAAAAC
AAGGCAAATATTGCAAACTTTTTTGAAAAGGCGCGCAACAATGACAAGCACGAGGAAAAGCACACCAAGATTAAA
GGTACAAGGCATTCCGAGCCAAGTCTTGGTGTGCCCGAGGGCTCAAACACGACCCATAATGTCAAGTCGAATTCC
AAAGACACAGAAATCCACGAGGAAAAAGACATCAAGAACAAACAAGAGTCGGAATCGTCTCTACCTGCACCGCAA
AGCAAAAACCTACACTCTTCTTCCAAGCGCAAAACACCTCCAGCCACCCCAAAGAGCTCACCTTTCAAAAAGATT
AGCGCAACACATAGCCAACACCCTTCACCCGCCAAGACCAAAGCCAAGGGCTCGCAAAAGATTACAAACTTTTTT
AACCACAAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail