Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5423
Gene name
LocationContig_41:112952..114902
Strand-
Gene length (bp)1950
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 4.6E-29 51 163

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 68 90 22
3 133 155 22
4 559 581 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5423
MSEVTKMEQIGLWTQDVGSAEHIRDRSLFRCWCWEVASLITATGLAIAIFVVLDSYDGQELPQWPYSINLNTLAA
MATLCLRASLVIVAAEIIGQAKWIYFSKGGQQVADFQIFDEASRGLLGSIKLISLLRFGWRGSPIAVAAAFTTVF
SLSISPLTQQAIKATPCSRVRGLNHARIPVALEVPGADYYYFDYGETQSYELGAKAKYTMIAGIANPHSNESSIQ
AKTICPTGNCTFPETLDIPHSTIGLCASCMDMTPMLNISMLDRDDDDKFQPFEATLGDLSVSIQKSNTWLAVGST
NLSFARSILDAEFLDAARQACTNVSVITYSQTPSQHCKGEALSPDCVIAASCSLYPCMKDIKAQVIDGRLEDTVV
RTVPARENPLADHRNQTGQGPDHSAIKSPCMIEGHRYDVSNFSLVPFDAQKRTFIKVPIDGKTVDVPSDCVYTMT
GVYHYAIQDYIEEELFSGECNDTMKQREHLACGSHWWLHTFYNKANASFDSISTTVQDMATATTNFFRLDGWGPI
HDLEVYQQGGDSDMYKTFLQGKVHETTICMRLEWPWLFVPGVLCLTTITLFAAMLISNARKHKQPVWKSSTLPLL
LFGLDTHKLEEGSCALDDLQRQAECTTATLDLSGIYPRPALVALDRLGT*
Coding >OphauB2|5423
ATGTCAGAGGTTACAAAGATGGAGCAAATTGGACTCTGGACGCAAGATGTAGGCAGCGCAGAGCACATTAGGGAT
CGCAGCCTCTTTCGCTGTTGGTGCTGGGAAGTCGCTTCACTCATCACAGCCACTGGCCTTGCCATTGCCATTTTT
GTGGTGCTGGATAGCTATGACGGCCAAGAACTTCCACAGTGGCCCTACAGCATCAATCTCAACACTTTAGCTGCC
ATGGCCACGCTCTGTCTCCGCGCCAGCCTTGTCATTGTTGCGGCTGAGATTATCGGCCAAGCGAAATGGATCTAC
TTTTCCAAGGGCGGACAGCAAGTGGCCGACTTTCAGATATTTGACGAGGCCAGCCGTGGTCTTTTGGGTTCAATC
AAGCTAATCTCACTGCTGCGTTTTGGCTGGCGTGGAAGCCCCATTGCTGTGGCGGCCGCCTTTACAACTGTCTTC
AGCCTTTCAATCAGCCCTTTGACACAACAGGCCATCAAAGCCACTCCCTGCTCGCGGGTAAGAGGCCTGAACCAT
GCAAGAATTCCTGTGGCTCTCGAGGTCCCAGGGGCAGACTACTACTACTTTGACTATGGGGAGACGCAGTCATAC
GAACTAGGCGCCAAAGCAAAGTATACCATGATTGCTGGCATCGCGAATCCTCATAGCAATGAGAGCAGTATCCAG
GCAAAGACAATTTGTCCAACTGGCAACTGCACCTTTCCAGAGACGTTGGACATTCCTCATTCAACTATAGGGCTG
TGTGCCTCTTGCATGGATATGACGCCCATGCTCAATATTTCCATGTTGGACCGGGATGATGATGACAAGTTTCAG
CCCTTTGAAGCCACGCTGGGGGACTTGTCTGTAAGCATTCAAAAGTCAAATACGTGGCTTGCCGTTGGATCAACC
AACCTATCATTTGCTCGATCGATCCTCGATGCCGAGTTCCTAGATGCTGCTCGACAGGCCTGTACCAACGTCTCA
GTCATAACATACTCTCAAACACCATCTCAGCACTGCAAAGGAGAAGCTCTGAGCCCTGATTGCGTCATTGCAGCC
TCTTGTTCTCTCTATCCCTGCATGAAGGACATCAAGGCGCAAGTCATAGATGGCCGACTCGAGGACACTGTCGTT
AGGACAGTTCCTGCAAGGGAAAATCCACTGGCAGATCACCGCAACCAGACTGGACAAGGACCTGACCATTCTGCG
ATTAAGAGTCCGTGCATGATTGAGGGTCACCGATATGACGTTTCCAATTTTTCCCTCGTGCCATTCGATGCTCAA
AAGCGGACTTTTATCAAGGTGCCAATCGACGGCAAGACTGTTGACGTGCCGTCAGATTGTGTATACACCATGACT
GGAGTTTATCACTATGCCATACAAGACTATATTGAAGAAGAGTTGTTCTCTGGGGAGTGCAACGACACGATGAAG
CAGCGCGAACATCTGGCATGTGGATCCCATTGGTGGCTTCACACCTTTTATAACAAAGCAAACGCGTCTTTTGAC
AGCATTAGCACAACCGTTCAAGACATGGCAACAGCCACAACAAACTTCTTCCGCCTCGACGGATGGGGCCCCATT
CACGACCTCGAGGTCTACCAGCAGGGCGGTGATTCCGACATGTACAAAACATTTCTTCAAGGCAAAGTACACGAG
ACAACCATTTGCATGCGCCTCGAGTGGCCATGGTTATTTGTCCCTGGAGTCCTTTGTCTCACCACCATAACGCTC
TTTGCCGCCATGCTCATCTCCAACGCCCGCAAACATAAACAACCCGTCTGGAAGTCGAGCACTTTGCCACTTTTA
TTATTTGGACTGGATACACATAAACTGGAAGAGGGATCATGTGCTCTGGATGACTTGCAGCGACAGGCAGAGTGC
ACCACAGCGACTCTGGACCTTAGTGGTATTTATCCACGTCCTGCACTTGTGGCTCTAGATAGATTGGGCACCTGA
Transcript >OphauB2|5423
ATGTCAGAGGTTACAAAGATGGAGCAAATTGGACTCTGGACGCAAGATGTAGGCAGCGCAGAGCACATTAGGGAT
CGCAGCCTCTTTCGCTGTTGGTGCTGGGAAGTCGCTTCACTCATCACAGCCACTGGCCTTGCCATTGCCATTTTT
GTGGTGCTGGATAGCTATGACGGCCAAGAACTTCCACAGTGGCCCTACAGCATCAATCTCAACACTTTAGCTGCC
ATGGCCACGCTCTGTCTCCGCGCCAGCCTTGTCATTGTTGCGGCTGAGATTATCGGCCAAGCGAAATGGATCTAC
TTTTCCAAGGGCGGACAGCAAGTGGCCGACTTTCAGATATTTGACGAGGCCAGCCGTGGTCTTTTGGGTTCAATC
AAGCTAATCTCACTGCTGCGTTTTGGCTGGCGTGGAAGCCCCATTGCTGTGGCGGCCGCCTTTACAACTGTCTTC
AGCCTTTCAATCAGCCCTTTGACACAACAGGCCATCAAAGCCACTCCCTGCTCGCGGGTAAGAGGCCTGAACCAT
GCAAGAATTCCTGTGGCTCTCGAGGTCCCAGGGGCAGACTACTACTACTTTGACTATGGGGAGACGCAGTCATAC
GAACTAGGCGCCAAAGCAAAGTATACCATGATTGCTGGCATCGCGAATCCTCATAGCAATGAGAGCAGTATCCAG
GCAAAGACAATTTGTCCAACTGGCAACTGCACCTTTCCAGAGACGTTGGACATTCCTCATTCAACTATAGGGCTG
TGTGCCTCTTGCATGGATATGACGCCCATGCTCAATATTTCCATGTTGGACCGGGATGATGATGACAAGTTTCAG
CCCTTTGAAGCCACGCTGGGGGACTTGTCTGTAAGCATTCAAAAGTCAAATACGTGGCTTGCCGTTGGATCAACC
AACCTATCATTTGCTCGATCGATCCTCGATGCCGAGTTCCTAGATGCTGCTCGACAGGCCTGTACCAACGTCTCA
GTCATAACATACTCTCAAACACCATCTCAGCACTGCAAAGGAGAAGCTCTGAGCCCTGATTGCGTCATTGCAGCC
TCTTGTTCTCTCTATCCCTGCATGAAGGACATCAAGGCGCAAGTCATAGATGGCCGACTCGAGGACACTGTCGTT
AGGACAGTTCCTGCAAGGGAAAATCCACTGGCAGATCACCGCAACCAGACTGGACAAGGACCTGACCATTCTGCG
ATTAAGAGTCCGTGCATGATTGAGGGTCACCGATATGACGTTTCCAATTTTTCCCTCGTGCCATTCGATGCTCAA
AAGCGGACTTTTATCAAGGTGCCAATCGACGGCAAGACTGTTGACGTGCCGTCAGATTGTGTATACACCATGACT
GGAGTTTATCACTATGCCATACAAGACTATATTGAAGAAGAGTTGTTCTCTGGGGAGTGCAACGACACGATGAAG
CAGCGCGAACATCTGGCATGTGGATCCCATTGGTGGCTTCACACCTTTTATAACAAAGCAAACGCGTCTTTTGAC
AGCATTAGCACAACCGTTCAAGACATGGCAACAGCCACAACAAACTTCTTCCGCCTCGACGGATGGGGCCCCATT
CACGACCTCGAGGTCTACCAGCAGGGCGGTGATTCCGACATGTACAAAACATTTCTTCAAGGCAAAGTACACGAG
ACAACCATTTGCATGCGCCTCGAGTGGCCATGGTTATTTGTCCCTGGAGTCCTTTGTCTCACCACCATAACGCTC
TTTGCCGCCATGCTCATCTCCAACGCCCGCAAACATAAACAACCCGTCTGGAAGTCGAGCACTTTGCCACTTTTA
TTATTTGGACTGGATACACATAAACTGGAAGAGGGATCATGTGCTCTGGATGACTTGCAGCGACAGGCAGAGTGC
ACCACAGCGACTCTGGACCTTAGTGGTATTTATCCACGTCCTGCACTTGTGGCTCTAGATAGATTGGGCACCTGA
Gene >OphauB2|5423
ATGTCAGAGGTTACAAAGATGGAGCAAATTGGACTCTGGACGCAAGATGTAGGCAGCGCAGAGCACATTAGGGAT
CGCAGCCTCTTTCGCTGTTGGTGCTGGGAAGTCGCTTCACTCATCACAGCCACTGGCCTTGCCATTGCCATTTTT
GTGGTGCTGGATAGCTATGACGGCCAAGAACTTCCACAGTGGCCCTACAGCATCAATCTCAACACTTTAGCTGCC
ATGGCCACGCTCTGTCTCCGCGCCAGCCTTGTCATTGTTGCGGCTGAGATTATCGGCCAAGCGAAATGGATCTAC
TTTTCCAAGGGCGGACAGCAAGTGGCCGACTTTCAGATATTTGACGAGGCCAGCCGTGGTCTTTTGGGTTCAATC
AAGCTAATCTCACTGCTGCGTTTTGGCTGGCGTGGAAGCCCCATTGCTGTGGCGGCCGCCTTTACAACTGTCTTC
AGCCTTTCAATCAGCCCTTTGACACAACAGGCCATCAAAGCCACTCCCTGCTCGCGGGTAAGAGGCCTGAACCAT
GCAAGAATTCCTGTGGCTCTCGAGGTCCCAGGGGCAGACTACTACTACTTTGACTATGGGGAGACGCAGTCATAC
GAACTAGGCGCCAAAGCAAAGTATACCATGATTGCTGGCATCGCGAATCCTCATAGCAATGAGAGCAGTATCCAG
GCAAAGACAATTTGTCCAACTGGCAACTGCACCTTTCCAGAGACGTTGGACATTCCTCATTCAACTATAGGGCTG
TGTGCCTCTTGCATGGATATGACGCCCATGCTCAATATTTCCATGTTGGACCGGGATGATGATGACAAGTTTCAG
CCCTTTGAAGCCACGCTGGGGGACTTGTCTGTAAGCATTCAAAAGTCAAATACGTGGCTTGCCGTTGGATCAACC
AACCTATCATTTGCTCGATCGATCCTCGATGCCGAGTTCCTAGATGCTGCTCGACAGGCCTGTACCAACGTCTCA
GTCATAACATACTCTCAAACACCATCTCAGCACTGCAAAGGAGAAGCTCTGAGCCCTGATTGCGTCATTGCAGCC
TCTTGTTCTCTCTATCCCTGCATGAAGGACATCAAGGCGCAAGTCATAGATGGCCGACTCGAGGACACTGTCGTT
AGGACAGTTCCTGCAAGGGAAAATCCACTGGCAGATCACCGCAACCAGACTGGACAAGGACCTGACCATTCTGCG
ATTAAGAGTCCGTGCATGATTGAGGGTCACCGATATGACGTTTCCAATTTTTCCCTCGTGCCATTCGATGCTCAA
AAGCGGACTTTTATCAAGGTGCCAATCGACGGCAAGACTGTTGACGTGCCGTCAGATTGTGTATACACCATGACT
GGAGTTTATCACTATGCCATACAAGACTATATTGAAGAAGAGTTGTTCTCTGGGGAGTGCAACGACACGATGAAG
CAGCGCGAACATCTGGCATGTGGATCCCATTGGTGGCTTCACACCTTTTATAACAAAGCAAACGCGTCTTTTGAC
AGCATTAGCACAACCGTTCAAGACATGGCAACAGCCACAACAAACTTCTTCCGCCTCGACGGATGGGGCCCCATT
CACGACCTCGAGGTCTACCAGCAGGGCGGTGATTCCGACATGTACAAAACATTTCTTCAAGGCAAAGTACACGAG
ACAACCATTTGCATGCGCCTCGAGTGGCCATGGTTATTTGTCCCTGGAGTCCTTTGTCTCACCACCATAACGCTC
TTTGCCGCCATGCTCATCTCCAACGCCCGCAAACATAAACAACCCGTCTGGAAGTCGAGCACTTTGCCACTTTTA
TTATTTGGACTGGATACACATAAACTGGAAGAGGGATCATGTGCTCTGGATGACTTGCAGCGACAGGCAGAGTGC
ACCACAGCGACTCTGGACCTTAGTGGTATTTATCCACGTCCTGCACTTGTGGCTCTAGATAGATTGGGCACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail