Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5412
Gene name
LocationContig_41:80258..81890
Strand-
Gene length (bp)1632
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.2E-09 160 426

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATH2|CARP1_ARTBC Probable secreted aspartic protease ARB_07536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07536 PE=1 SV=1 66 426 2.0E-98
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 197 425 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5412
MTSSMLRILTAVVCVMGGVAALHQHRCRASAPWNCTGSGKTGRDSRRVHDWLLDASPLGFVARAGIGSPRFEHNV
FVDWTWIGHIVTTPRCFGQWNARLCFHAHQVVWDPRTSVSWANLSDTYGPRTWLPNHFFMQHAMHVEYASDEVQI
GPASGRAVLQLTDLDFDASQFGFAYPFTGVFGMSPVFAGNDADYQSPFYQQWKQGVWQRGLAGFVYCHDEWSKHA
VCKGHDGIQTLGGIRGDLVGRGKIWWYHVKVYPDVNQLDFVYKPAVLNYWAIELDGLRIGAETQRLEPTSERSGK
GAIFDHASYGRGVALTVNAYARLVALTGGRRVQLANPPNNGAQDFYAVECARLDTFPSLAYRFLGHAREWIVTPQ
MYVAKTANGTCVLNVRTLASGDQFIGNFGETFAKEKYIVLDFEKNRLGIADVLWPLS*
Coding >OphauB2|5412
ATGACGAGCAGCATGTTGAGAATACTGACCGCCGTGGTGTGCGTCATGGGCGGAGTGGCAGCCCTACATCAGCAC
CGATGCCGTGCTTCAGCTCCATGGAACTGTACCGGATCTGGTAAGACGGGCAGAGACAGCCGGCGGGTGCATGAT
TGGCTGCTGGACGCGAGTCCCCTGGGTTTCGTGGCCAGAGCTGGCATTGGGAGCCCGCGCTTCGAGCACAATGTC
TTTGTCGACTGGACGTGGATCGGGCATATTGTCACGACGCCCCGGTGCTTTGGCCAGTGGAATGCGCGCCTGTGC
TTCCATGCCCATCAAGTTGTCTGGGATCCGCGCACTTCAGTCTCCTGGGCTAACCTGTCGGACACATATGGCCCT
CGCACATGGCTGCCAAATCACTTCTTTATGCAGCACGCCATGCATGTCGAGTACGCGTCAGACGAGGTCCAGATT
GGGCCAGCCAGTGGCCGCGCTGTCTTGCAGCTGACGGACCTGGACTTTGACGCCTCTCAATTCGGCTTTGCATAC
CCCTTTACCGGAGTCTTTGGCATGTCACCAGTCTTTGCAGGCAATGACGCCGACTACCAATCTCCCTTTTACCAG
CAATGGAAGCAAGGGGTCTGGCAGAGAGGCTTGGCTGGCTTTGTCTACTGCCACGATGAATGGAGCAAGCATGCC
GTCTGCAAGGGCCACGACGGCATACAGACGCTGGGTGGCATTCGCGGCGATCTTGTTGGCCGTGGCAAGATTTGG
TGGTACCATGTCAAAGTATATCCAGACGTCAACCAACTCGACTTTGTATACAAGCCAGCAGTCCTCAACTACTGG
GCCATTGAGCTCGACGGCCTGCGCATCGGAGCCGAGACGCAGCGGCTTGAGCCCACGTCAGAAAGGTCGGGAAAA
GGGGCAATATTCGACCACGCCAGCTACGGCCGTGGCGTTGCGCTTACTGTCAACGCGTACGCCAGACTTGTCGCA
CTGACGGGGGGCAGACGCGTCCAATTGGCAAACCCGCCGAATAATGGCGCCCAAGACTTTTATGCCGTGGAATGC
GCCCGCCTAGACACCTTTCCCAGCCTGGCATACCGCTTTCTAGGCCACGCGCGCGAATGGATAGTCACGCCGCAA
ATGTACGTTGCCAAGACGGCCAACGGGACCTGCGTGCTAAACGTCCGGACCCTAGCCAGCGGAGATCAATTCATC
GGTAATTTTGGAGAGACCTTTGCCAAGGAGAAATACATTGTTCTCGACTTTGAGAAGAACCGGCTAGGTATTGCC
GACGTTTTATGGCCGCTCAGCTGA
Transcript >OphauB2|5412
ATGACGAGCAGCATGTTGAGAATACTGACCGCCGTGGTGTGCGTCATGGGCGGAGTGGCAGCCCTACATCAGCAC
CGATGCCGTGCTTCAGCTCCATGGAACTGTACCGGATCTGGTAAGACGGGCAGAGACAGCCGGCGGGTGCATGAT
TGGCTGCTGGACGCGAGTCCCCTGGGTTTCGTGGCCAGAGCTGGCATTGGGAGCCCGCGCTTCGAGCACAATGTC
TTTGTCGACTGGACGTGGATCGGGCATATTGTCACGACGCCCCGGTGCTTTGGCCAGTGGAATGCGCGCCTGTGC
TTCCATGCCCATCAAGTTGTCTGGGATCCGCGCACTTCAGTCTCCTGGGCTAACCTGTCGGACACATATGGCCCT
CGCACATGGCTGCCAAATCACTTCTTTATGCAGCACGCCATGCATGTCGAGTACGCGTCAGACGAGGTCCAGATT
GGGCCAGCCAGTGGCCGCGCTGTCTTGCAGCTGACGGACCTGGACTTTGACGCCTCTCAATTCGGCTTTGCATAC
CCCTTTACCGGAGTCTTTGGCATGTCACCAGTCTTTGCAGGCAATGACGCCGACTACCAATCTCCCTTTTACCAG
CAATGGAAGCAAGGGGTCTGGCAGAGAGGCTTGGCTGGCTTTGTCTACTGCCACGATGAATGGAGCAAGCATGCC
GTCTGCAAGGGCCACGACGGCATACAGACGCTGGGTGGCATTCGCGGCGATCTTGTTGGCCGTGGCAAGATTTGG
TGGTACCATGTCAAAGTATATCCAGACGTCAACCAACTCGACTTTGTATACAAGCCAGCAGTCCTCAACTACTGG
GCCATTGAGCTCGACGGCCTGCGCATCGGAGCCGAGACGCAGCGGCTTGAGCCCACGTCAGAAAGGTCGGGAAAA
GGGGCAATATTCGACCACGCCAGCTACGGCCGTGGCGTTGCGCTTACTGTCAACGCGTACGCCAGACTTGTCGCA
CTGACGGGGGGCAGACGCGTCCAATTGGCAAACCCGCCGAATAATGGCGCCCAAGACTTTTATGCCGTGGAATGC
GCCCGCCTAGACACCTTTCCCAGCCTGGCATACCGCTTTCTAGGCCACGCGCGCGAATGGATAGTCACGCCGCAA
ATGTACGTTGCCAAGACGGCCAACGGGACCTGCGTGCTAAACGTCCGGACCCTAGCCAGCGGAGATCAATTCATC
GGTAATTTTGGAGAGACCTTTGCCAAGGAGAAATACATTGTTCTCGACTTTGAGAAGAACCGGCTAGGTATTGCC
GACGTTTTATGGCCGCTCAGCTGA
Gene >OphauB2|5412
ATGGTGAGTATGCGCCACGTTGCCGCCGTGGCTGCTGCATCACGCTACGTCGCCAAGACAAGTGGCTGACGTGTT
GTCCCCCCCGGGCTGTTTCCTAAGCAGACGAGCAGCATGTTGAGAATACTGACCGCCGTGGTGTGCGTCATGGGC
GGAGTGGCAGCCCTACATCAGCACCGATGCCGTGCTTCAGCTCCATGGAACTGTACCGGATCTGGTAAGACGGGC
AGAGACAGCCGGCGGGTGCATGATTGGCTGCTGGACGCGAGTCCCCTGGGTTTCGTGGCCAGAGCTGGCATTGGG
AGCCCGCGCTTCGAGCACAATGTCTTTGTCGACTGGACGTGGATCGGGCATATTGTCACGACGCCCCGGTGCTTT
GGCCAGTGGAATGCGCGCCTGTGCTTCCATGCCCATCAAGTTGTCTGGGATCCGCGCACTTCAGTCTCCTGGGCT
AACCTGTCGGACACATATGGCCCTCGCACATGGCTGCCAAATCACTTCTTTATGCAGCACGCCATGCATGTCGAG
TACGCGTCAGACGAGGTCCAGATTGGGCCAGCCAGTGGCCGCGCTGTCTTGCAGCTGACGGACCTGGACTTTGAC
GCCTCTCAATTCGGCTTTGCATACCCCTTTACCGGAGTCTTTGGCATGTCACCAGTCTTTGCAGGCAATGACGGT
TAGTGCTGCTGCTTGTACAAGTCTTGCTTTTCCTTGCTTTTCTGTGGCAGAGACAGGGGAGCTGATGGGCGTTGG
TGGCGCGCGTCATGCAGCCGACTACCAATCTCCCTTTTACCAGCAATGGAAGCAAGGGGTCTGGCAGAGAGGCTT
GGCTGGCTTTGTCTACTGCCACGATGAATGGAGCAAGCATGCCGTCTGCAAGGGCCACGACGGCATACAGACGCT
GGGTGGCATTCGCGGCGATCTTGTTGGCCGTGGCAAGATTTGGTGGTACCATGTCAAAGTATATCCAGACGTCAA
CCAACTCGACTTTGTATACAAGCCAGCAGTCCTCAACTACTGGGCCATTGAGCTCGACGGCCTGCGCATCGGAGC
CGAGACGCAGCGGCTTGAGCCCACGTCAGAAAGGTCGGGAAAAGGGGCAATATTCGACCACGCCAGCTACGGCCG
TGGCGTTGCGCTTACTGTCAACGCGTACGCCAGACTTGTCGCACTGACGGGGGGCAGACGCGTCCAATTGGCAAA
CCCGCCGAATAATGGCGCCCAAGACTTTTATGCCGTGGAATGCGCCCGCCTAGACACCTTTCCCAGCCTGGCATA
CCGCTTTCTAGGCCACGCGCGCGAATGGATAGTCACGCCGCAAATGTACGTTGCCAAGACGGCCAACGGGACCTG
CGTGCTAAACGTCCGGACCCTAGCCAGCGGAGATCAATTGTAAGTCATTACAGCCGTCCGAGACATGATTTACCA
TCTGACAGCGGGGGCCCCTCCCCCAGCATCGGTAATTTTGGAGAGACCTTTGCCAAGGAGAAATACATTGTTCTC
GACTTTGAGAAGAACCGGCTAGGTATTGCCGACGTTTTATGGTAAATGCTAATTATATCCCCCGCCTTGTGCGCC
CGACCTTGTGGCGGTCGACATTGAATGACTGAGTGTCATGGCAGGCCGCTCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail