Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5406
Gene name
LocationContig_41:46603..58730
Strand-
Gene length (bp)12127
Transcript length (bp)11775
Coding sequence length (bp)11775
Protein length (aa) 3925

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.5E-81 2860 3270
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.3E-74 12 260
PF00668 Condensation Condensation domain 1.8E-59 2371 2834
PF14765 PS-DH Polyketide synthase dehydratase 3.3E-57 933 1250
PF08659 KR KR domain 1.3E-55 1962 2136
PF00698 Acyl_transf_1 Acyl transferase domain 1.4E-53 543 860
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.1E-37 269 385
PF07993 NAD_binding_4 Male sterility protein 1.5E-34 3525 3786
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.5E-18 1797 1936
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.9E-19 388 511
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.2E-17 1761 1870
PF00550 PP-binding Phosphopantetheine attachment site 3.9E-07 2254 2314
PF00550 PP-binding Phosphopantetheine attachment site 4.9E-07 3412 3474
PF00106 adh_short short chain dehydrogenase 2.0E-07 1961 2136
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 2.5E-05 3287 3366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 8 1168 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1247 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 10 1274 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 10 1274 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1246 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 8 1168 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1247 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 10 1274 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 10 1274 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1246 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1955 3863 2.0E-160
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 9 917 2.0E-143
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 11 1171 2.0E-143
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 6 1176 4.0E-141
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 11 1172 5.0E-138
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 10 917 5.0E-137
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2366 3862 7.0E-134
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 15 1172 9.0E-134
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 917 2.0E-130
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 923 2.0E-130
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 9 1163 3.0E-128
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 11 1251 6.0E-128
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 11 1251 6.0E-128
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 11 1251 6.0E-128
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 9 1163 8.0E-126
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 12 986 2.0E-123
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 11 832 3.0E-123
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 12 1243 1.0E-122
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 11 832 2.0E-122
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 920 3.0E-122
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 920 3.0E-122
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 920 3.0E-122
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 8 979 3.0E-121
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2374 3729 4.0E-121
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 11 832 7.0E-121
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 917 3.0E-120
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 917 7.0E-120
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 76 990 1.0E-118
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 917 2.0E-118
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 81 990 1.0E-117
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 15 1179 1.0E-116
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 81 990 1.0E-115
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 81 990 2.0E-115
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 3 990 5.0E-115
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 9 1165 8.0E-115
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 9 1165 8.0E-115
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 3 979 9.0E-115
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 11 1036 1.0E-114
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 8 984 2.0E-114
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 15 979 3.0E-114
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 15 980 1.0E-113
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 14 1012 3.0E-113
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 27 979 4.0E-113
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 81 1188 6.0E-113
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1495 2310 1.0E-112
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 15 979 1.0E-112
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 8 984 2.0E-112
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 11 1014 2.0E-112
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 9 979 4.0E-112
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 11 1014 1.0E-111
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 14 1014 1.0E-110
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2292 3450 3.0E-110
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 64 978 3.0E-110
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 64 978 8.0E-109
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 997 4.0E-108
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 10 979 7.0E-108
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 11 1014 1.0E-107
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2374 3444 5.0E-107
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2314 3447 1.0E-106
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 4 979 1.0E-105
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 15 1013 2.0E-105
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 15 1014 8.0E-105
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2356 3456 4.0E-104
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 76 980 5.0E-103
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 65 979 1.0E-102
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2356 3458 3.0E-102
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 80 979 4.0E-100
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2364 3475 4.0E-100
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 10 979 3.0E-99
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 11 434 3.0E-99
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 80 979 5.0E-99
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 919 1.0E-98
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 919 2.0E-98
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 919 2.0E-98
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2356 3456 1.0E-97
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 80 979 1.0E-97
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 80 979 1.0E-96
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 80 979 2.0E-96
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 2 979 4.0E-96
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2367 3477 9.0E-96
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 80 979 1.0E-95
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2367 3481 6.0E-95
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3478 8.0E-95
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2360 3492 2.0E-94
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 80 979 5.0E-94
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 80 979 1.0E-93
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2375 3474 4.0E-93
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3474 1.0E-92
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3474 2.0E-92
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2373 3474 3.0E-92
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 15 921 6.0E-92
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2363 3483 6.0E-91
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2367 3474 8.0E-91
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2367 3474 9.0E-91
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2277 3474 6.0E-90
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2374 3477 4.0E-89
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2364 3477 4.0E-89
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 10 513 8.0E-89
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2374 3477 2.0E-88
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 15 917 2.0E-88
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2369 3477 2.0E-88
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2375 3476 5.0E-88
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2360 3449 8.0E-88
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2379 3466 8.0E-88
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2503 3480 3.0E-87
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2375 3482 7.0E-87
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3476 6.0E-86
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2364 3478 1.0E-85
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2364 3492 2.0E-85
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 15 917 1.0E-84
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2293 3481 1.0E-84
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2370 3478 3.0E-84
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2364 3481 4.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2370 3475 1.0E-83
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2344 3466 1.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2364 3476 4.0E-83
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2368 3450 9.0E-83
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2364 3482 3.0E-82
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2368 3474 3.0E-82
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2329 3476 2.0E-81
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2366 3476 2.0E-81
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2348 3482 3.0E-81
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2344 3476 1.0E-80
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2555 3476 3.0E-80
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2638 3474 4.0E-80
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2357 3482 4.0E-80
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2334 3476 8.0E-80
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2370 3474 1.0E-79
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2370 3488 2.0E-79
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 522 3.0E-79
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2352 3478 5.0E-79
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1524 2331 5.0E-79
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1524 2331 5.0E-79
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2344 3476 1.0E-78
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2476 3499 1.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2315 3476 3.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2476 3471 3.0E-78
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2374 3531 7.0E-78
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 522 1.0E-77
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2364 3477 3.0E-77
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2374 3320 3.0E-77
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 522 1.0E-76
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2364 3475 3.0E-76
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2364 3485 4.0E-76
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 522 1.0E-75
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2374 3516 2.0E-75
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2364 3475 5.0E-75
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 15 522 4.0E-74
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2374 3474 5.0E-74
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2374 3471 1.0E-73
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 10 427 3.0E-73
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2374 3477 6.0E-73
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 15 522 1.0E-72
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1518 2139 4.0E-72
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2364 3450 8.0E-72
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 15 562 2.0E-71
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2367 3476 3.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 592 9.0E-71
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2641 3521 2.0E-70
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2411 3470 3.0E-70
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 14 378 4.0E-69
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1651 2144 2.0E-68
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 11 522 3.0E-68
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1651 2361 6.0E-68
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1651 2143 7.0E-68
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2877 3482 1.0E-67
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 512 8.0E-67
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2877 3477 4.0E-65
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1524 2322 5.0E-65
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 523 6.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2610 3504 4.0E-63
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1651 2143 4.0E-63
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2609 3790 2.0E-62
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1651 2141 6.0E-62
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1956 2743 2.0E-61
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1634 2316 5.0E-61
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2874 3449 1.0E-60
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2641 3790 5.0E-60
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1956 2743 1.0E-59
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2399 3474 4.0E-59
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1621 2167 8.0E-59
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2364 3477 3.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2408 3476 3.0E-58
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2861 3504 2.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2347 3474 2.0E-57
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2347 3474 2.0E-57
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2861 3504 2.0E-56
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2374 3477 4.0E-56
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 11 513 6.0E-56
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2850 3444 6.0E-56
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1599 2178 2.0E-54
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2877 3785 6.0E-54
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2864 3438 1.0E-53
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2864 3438 1.0E-53
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1654 2293 2.0E-53
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2823 3452 2.0E-53
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2823 3452 3.0E-53
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1635 2294 4.0E-53
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2823 3451 6.0E-53
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2355 3322 1.0E-52
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 15 522 2.0E-52
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2860 3449 5.0E-52
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1519 2293 5.0E-52
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2610 3790 2.0E-51
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1519 2293 3.0E-51
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2760 3476 3.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2777 3491 4.0E-51
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2784 3790 6.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2260 3479 3.0E-50
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 15 437 8.0E-50
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1643 2324 2.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2375 3470 7.0E-49
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2784 3455 2.0E-48
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2872 3377 2.0E-48
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 435 3.0E-48
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1639 2330 4.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2784 3455 5.0E-48
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2254 3484 5.0E-48
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2765 3507 2.0E-47
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2877 3482 4.0E-47
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2786 3469 8.0E-47
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2786 3469 1.0E-46
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2860 3450 1.0E-46
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2860 3450 1.0E-46
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2860 3450 1.0E-46
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2860 3370 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2764 3478 4.0E-46
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1644 2294 1.0E-45
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1639 2314 1.0E-45
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1638 2311 1.0E-45
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2258 3451 5.0E-45
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1644 2294 7.0E-45
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1644 2323 2.0E-44
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1586 2311 3.0E-43
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1627 2294 4.0E-43
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2915 3377 8.0E-43
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2614 3450 9.0E-43
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2719 3450 1.0E-42
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1638 2311 1.0E-42
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2547 3450 2.0E-42
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2633 3790 2.0E-42
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2877 3373 4.0E-42
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2868 3373 5.0E-42
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1556 2311 1.0E-41
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2877 3384 3.0E-41
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2868 3373 4.0E-41
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2877 3373 5.0E-41
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2877 3373 5.0E-41
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2860 3375 5.0E-41
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2501 3444 9.0E-41
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2471 3451 1.0E-40
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1638 2356 1.0E-40
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1586 2311 1.0E-40
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2514 3464 3.0E-40
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1586 2311 4.0E-40
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1638 2323 5.0E-40
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 501 1171 7.0E-40
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1638 2295 8.0E-40
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1638 2311 9.0E-40
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1586 2311 2.0E-39
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2860 3373 3.0E-39
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2854 3373 4.0E-39
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1633 2328 4.0E-39
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1644 2329 5.0E-39
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2859 3284 8.0E-39
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1638 2295 8.0E-39
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1639 2324 2.0E-38
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2854 3375 2.0E-38
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1638 2147 3.0E-38
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2856 3374 5.0E-38
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1622 2329 8.0E-38
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2874 3372 1.0E-37
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2856 3374 1.0E-37
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1633 2324 2.0E-37
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1633 2323 2.0E-37
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1644 2329 2.0E-37
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2856 3374 2.0E-37
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2874 3375 2.0E-37
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1638 2323 2.0E-37
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2874 3375 4.0E-37
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2559 3372 6.0E-37
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2874 3372 7.0E-37
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2874 3375 9.0E-37
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2874 3375 9.0E-37
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2874 3372 9.0E-37
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2874 3375 1.0E-36
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2874 3375 1.0E-36
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2854 3374 1.0E-36
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1639 2314 2.0E-36
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2874 3372 2.0E-36
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2874 3372 3.0E-36
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2860 3542 4.0E-36
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2854 3374 8.0E-36
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2854 3373 1.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2873 3482 1.0E-35
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2501 3508 2.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2854 3373 3.0E-35
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2862 3446 4.0E-35
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2864 3446 2.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2874 3372 3.0E-34
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2864 3446 3.0E-34
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1633 2346 5.0E-34
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1633 2323 2.0E-33
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2860 3475 2.0E-33
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2834 3477 5.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2821 3450 5.0E-33
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2854 3451 6.0E-33
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2850 3449 1.0E-32
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1633 2331 1.0E-32
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2579 3450 1.0E-32
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2862 3451 1.0E-32
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2876 3372 1.0E-32
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2579 3450 2.0E-32
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2874 3475 4.0E-32
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1519 2318 4.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2874 3373 4.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2874 3373 6.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2874 3373 6.0E-32
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2862 3498 6.0E-32
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2406 3374 2.0E-31
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2784 3450 2.0E-31
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2888 3372 6.0E-31
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2913 3372 1.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2874 3373 1.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2854 3374 2.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1902 2323 5.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2878 3450 5.0E-30
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1633 2323 2.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2852 3373 2.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2874 3373 2.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2874 3373 2.0E-29
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2863 3374 3.0E-29
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2579 3492 7.0E-29
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2799 3455 6.0E-28
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2798 3451 8.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2578 3439 1.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2785 3444 3.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2915 3375 7.0E-25
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2841 3470 9.0E-25
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2854 3372 2.0E-24
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1622 1938 3.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2239 3372 5.0E-24
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1638 1938 1.0E-23
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2906 3486 3.0E-23
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 541 1160 5.0E-23
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1608 1906 6.0E-23
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 14 434 7.0E-23
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1641 1938 7.0E-23
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2878 3457 8.0E-23
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2766 3474 1.0E-22
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1641 1885 1.0E-22
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 2860 3372 2.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 498 881 4.0E-22
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1614 1885 4.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2862 3444 6.0E-22
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1614 1885 6.0E-22
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1614 1885 9.0E-22
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1671 1885 1.0E-21
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1671 1885 1.0E-21
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1614 1885 2.0E-21
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 88 430 3.0E-21
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1614 1885 8.0E-21
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 3523 3832 8.0E-21
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 109 437 1.0E-20
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2855 3372 2.0E-20
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2872 3372 2.0E-20
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1632 1940 4.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2877 3373 6.0E-20
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 2865 3372 6.0E-20
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 91 437 7.0E-20
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2850 3372 8.0E-20
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 2866 3372 1.0E-19
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1631 1936 1.0E-19
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 2865 3372 2.0E-19
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2850 3372 2.0E-19
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 88 439 2.0E-19
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 88 439 2.0E-19
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 88 439 2.0E-19
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 2877 3374 2.0E-19
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1929 2166 2.0E-19
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 88 439 3.0E-19
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 2865 3372 3.0E-19
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2878 3369 3.0E-19
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1671 1853 4.0E-19
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2876 3372 6.0E-19
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 88 439 7.0E-19
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 88 439 7.0E-19
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 160 439 7.0E-19
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2876 3377 8.0E-19
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1977 2321 8.0E-19
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1977 2321 8.0E-19
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1977 2321 9.0E-19
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 88 436 1.0E-18
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 88 435 1.0E-18
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2875 3379 1.0E-18
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2331 2828 1.0E-18
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2869 3372 2.0E-18
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2875 3379 2.0E-18
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2855 3377 3.0E-18
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 88 436 6.0E-18
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 78 435 6.0E-18
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 2873 3372 7.0E-18
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1643 1936 8.0E-18
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 162 434 1.0E-17
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 2865 3372 1.0E-17
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1960 2163 1.0E-17
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1632 1936 2.0E-17
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2878 3450 2.0E-17
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1613 1936 2.0E-17
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 24 430 2.0E-17
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1639 1929 2.0E-17
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2873 3372 2.0E-17
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 180 437 3.0E-17
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 180 437 3.0E-17
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 180 437 3.0E-17
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 88 436 5.0E-17
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 2878 3372 6.0E-17
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 2873 3377 6.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 88 437 7.0E-17
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 2877 3372 7.0E-17
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 2877 3372 1.0E-16
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3002 3318 1.0E-16
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 2872 3372 1.0E-16
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1649 1941 2.0E-16
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 2865 3372 2.0E-16
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 2859 3372 2.0E-16
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 142 438 2.0E-16
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2854 3374 3.0E-16
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 2877 3372 3.0E-16
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 77 437 3.0E-16
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 2837 3372 3.0E-16
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 88 437 4.0E-16
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 2866 3372 4.0E-16
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2869 3372 4.0E-16
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 2870 3372 4.0E-16
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1963 2299 5.0E-16
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 164 436 6.0E-16
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 2870 3372 7.0E-16
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 88 437 8.0E-16
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 162 434 1.0E-15
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 2877 3372 1.0E-15
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 2873 3372 1.0E-15
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2875 3372 1.0E-15
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 2866 3372 2.0E-15
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 78 436 2.0E-15
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 2870 3372 2.0E-15
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2873 3372 2.0E-15
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 2912 3383 2.0E-15
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1934 2350 2.0E-15
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1934 2350 2.0E-15
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1934 2350 2.0E-15
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 2877 3372 3.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1976 2140 3.0E-15
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 2877 3372 6.0E-15
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 14 437 6.0E-15
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 2994 3791 7.0E-15
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 2854 3372 7.0E-15
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 2865 3372 7.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1962 2374 8.0E-15
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 162 434 8.0E-15
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 2876 3372 9.0E-15
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 2870 3372 1.0E-14
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1633 1936 1.0E-14
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 2870 3372 1.0E-14
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 2873 3372 1.0E-14
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 2873 3372 1.0E-14
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 2873 3372 1.0E-14
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 2877 3372 1.0E-14
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 165 438 2.0E-14
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 2870 3372 2.0E-14
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 2877 3372 2.0E-14
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1671 1897 2.0E-14
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 180 437 2.0E-14
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 2870 3397 2.0E-14
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 2865 3372 2.0E-14
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 159 394 2.0E-14
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 2865 3372 2.0E-14
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 2873 3372 2.0E-14
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2834 3372 3.0E-14
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 2854 3372 3.0E-14
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2878 3374 3.0E-14
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 2852 3372 3.0E-14
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 2870 3372 4.0E-14
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 2877 3391 4.0E-14
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2844 3372 4.0E-14
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2844 3372 5.0E-14
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2875 3372 5.0E-14
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2877 3379 5.0E-14
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 109 437 5.0E-14
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2860 3374 5.0E-14
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2860 3374 5.0E-14
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1644 1941 7.0E-14
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 2854 3372 7.0E-14
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 2873 3409 8.0E-14
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2850 3378 1.0E-13
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2903 3375 1.0E-13
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2844 3372 1.0E-13
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 2870 3372 1.0E-13
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 2877 3372 1.0E-13
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 180 437 1.0E-13
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 180 437 1.0E-13
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 180 437 1.0E-13
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 180 437 1.0E-13
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 2849 3372 1.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2876 3374 1.0E-13
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 2877 3372 1.0E-13
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 2870 3372 2.0E-13
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 9 394 2.0E-13
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 2877 3372 2.0E-13
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 2 444 2.0E-13
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 14 394 2.0E-13
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2875 3372 2.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1977 2172 3.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1977 2172 3.0E-13
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 77 434 3.0E-13
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 2870 3372 3.0E-13
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 2871 3409 3.0E-13
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 2874 3372 3.0E-13
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1934 2129 3.0E-13
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 2870 3372 4.0E-13
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 2876 3396 4.0E-13
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 2854 3372 4.0E-13
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 2854 3372 4.0E-13
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 2877 3372 4.0E-13
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 3416 3821 4.0E-13
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 14 394 5.0E-13
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 180 437 5.0E-13
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2874 3372 5.0E-13
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2874 3372 5.0E-13
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 2877 3372 5.0E-13
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 540 844 5.0E-13
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 2870 3372 5.0E-13
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 543 838 5.0E-13
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 2870 3372 5.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 143 436 5.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 143 436 5.0E-13
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 37 140 6.0E-13
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 2870 3372 7.0E-13
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 2870 3372 7.0E-13
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2855 3378 8.0E-13
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 2877 3377 8.0E-13
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3002 3474 9.0E-13
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1632 1938 9.0E-13
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2844 3360 1.0E-12
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2980 3372 1.0E-12
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 2854 3372 1.0E-12
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 2872 3372 1.0E-12
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1960 2318 2.0E-12
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 2849 3372 2.0E-12
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2999 3375 2.0E-12
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 2870 3372 2.0E-12
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1648 1861 2.0E-12
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 2875 3372 2.0E-12
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2877 3372 2.0E-12
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2864 3372 2.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2838 3372 2.0E-12
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 2854 3372 3.0E-12
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 2877 3372 3.0E-12
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 2877 3372 3.0E-12
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 2870 3372 3.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2841 3377 3.0E-12
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1632 1851 3.0E-12
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 2877 3372 3.0E-12
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 2870 3372 3.0E-12
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 2877 3372 3.0E-12
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 540 845 3.0E-12
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 2870 3372 4.0E-12
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2856 3373 4.0E-12
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 14 437 4.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2674 3284 5.0E-12
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1632 1851 5.0E-12
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1689 1941 5.0E-12
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2869 3375 5.0E-12
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 2853 3378 5.0E-12
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 2870 3372 6.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2874 3372 6.0E-12
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 2870 3372 6.0E-12
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 2931 3374 6.0E-12
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 2874 3372 7.0E-12
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 2874 3372 7.0E-12
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 2875 3372 7.0E-12
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 2866 3372 7.0E-12
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 2870 3372 8.0E-12
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1618 1937 8.0E-12
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 2877 3372 8.0E-12
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 2877 3372 8.0E-12
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 2868 3372 9.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2878 3372 1.0E-11
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 3416 3821 1.0E-11
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 2877 3372 1.0E-11
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 2854 3372 1.0E-11
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 2877 3372 1.0E-11
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 14 394 1.0E-11
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 2877 3372 1.0E-11
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 2877 3372 1.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1954 2346 2.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2374 2735 2.0E-11
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 159 394 2.0E-11
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 2931 3369 2.0E-11
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2998 3375 2.0E-11
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 2877 3372 2.0E-11
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 2870 3372 2.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 143 437 2.0E-11
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 540 746 2.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2999 3377 2.0E-11
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2877 3370 2.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 3523 3804 3.0E-11
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 2877 3372 3.0E-11
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 2994 3372 3.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1640 1871 3.0E-11
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 2877 3372 3.0E-11
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2997 3372 3.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1963 2283 4.0E-11
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 2896 3377 4.0E-11
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 2877 3372 4.0E-11
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 3517 3736 9.0E-11
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1930 2153 1.0E-10
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 3523 3787 1.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1953 2315 3.0E-09
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1941 2133 5.0E-09
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1941 2133 5.0E-09
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1941 2133 5.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1939 2169 2.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 906 1163 4.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1957 2348 5.0E-08
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2375 2741 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0003824 catalytic activity Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5406
MSAEEACGTQDPTVIVGLACRVAGADTPSKLWENIAEQRDVQRKMPDKRFNVDAFFHPEPSHKGTTNARYGYFLD
QDVAKFDASFFGISGKEAEAMDPQQRLLLEVVYEALEDAGITLDEIRGSLTSVFCGSFTNDYNAMLTKDLESYPK
YTVTGTGNAILSNRISYFYDLHGTSVTIDTACSSSLVCFHLGSQTLQNGEADISLVVGSALHYDSNVFITMTDLG
MLSTNGRCAAFDASGSGYVRGEGIACAVLKRAADARAHGDVVRAVVRATGTNHDGGGGKKGITLPSGAAQERLIR
ETYARAGLDPADTQYFEAHGTGTAAGDPIEAAAVGAVFAAGRRGVLWMGSVKTNIGHLEGASGLAGIIKTTLALE
KGMIPPNMHFDTPNPKIDFAGCRLAVPTRVMAWEVAPGAVRRASINSFGYGGTNAHVVLEEYVAASQVAAEALEP
GHDDAQRPHLLPLTSHSPKAGELTEKALLEFLESASGVTLGSLAHSLSTRRTMHAQRSFIVSSSIASVAEQLCSA
RQHAPWTLAGKTPPRIGFVFTGQGAQWHGMARQLMSHCRLFTQTLERCDALLKTLPDGPEWSIVEELERPLDACR
LGETLYSQTICTALQVALVDLLACWGIRPAAVVGHSSGEVAAAYAAGILSLDGAVAAAYYRGLYMAASGEDSARG
GMMAVGLPEQKCRQELEAFAGRLVLAAVNSPFTMTVSGDEDALTELGDLLLAEKVFVRRLAVKQAFHSHHMVPLA
PAYQCALEQTAALKQGACVAQCRMFSSVTARLADPMGMGAAYWAANMVQPVRFSDALTGILLDERDEQNVDVLVE
IGPHPALRGPARQTAQALRLDLPYIGSLARGVADFESLLSMAGTLFCLGCAVDLAAVNAKLSRAADGSLVQTATG
SRLDKLPTYSWQHGRYWAETRVIREHRQRPFRHSLLGHGVAGSVARRPRFRNYLRLSELPWLSGHVVENKAVFPG
AGYISMAVEAAVRTDELDGVEMVQVKQVVIKKALLIPSTDEGVEVVVELEPVVLSARSQSDTWYKFEVFSYDDGS
NCTSHCHGLISVARGRAAPLDASCLTTDKSAASSLSFTELRKRTWRSVPAHSFYKSMAKLGLCYGDCFRLLRGSI
ESGEGFAMSELVFDPSVLPSEAGDETILHPTLLDAFFHVMFLAIQERLGRPLDEPYVPSYLASLKLSGRFFDLRH
DRGVKRFCVASFTKLPSPRVAMSSLFMRDETDDLVMDISGLELTSLGRHVVEGQAPRALFYRLRWQPCFDLLPDG
QEAALPELIDLYAHQYPNASMLYIAADLEHMDGLLRRLGVLQGERRRLKHMDVWCAGRSGDDLVAGAEELCKTSR
GLVTVVSAPERASYDVVIVNEAVSDAALFVKGSGHVVMSDLAVDSCTASGLVRVFRSKGYTAFRTLSDAYSAPTE
LSVIVPRATPSTRVASILEALHAAYPGRLLPITFDAIVSGSASPCSNVIVLAGLDESASEKTVFLGAQRLLTSVQ
KNIVWATEGATFATSRPESAIYLGLVRVASSENDALRALVFDFAAESPASSIAANLVRLLDTGIAEGEVAEQEGI
IYIPRVEADDERNCKLTNGPNQEPRLEPFGTPDTQTALALRIGKVGLLETLHFGQDEQVEDTELGDEDVEVETRA
SSINFRDVAASMGIIEDSELGDECAGLCTRVGSRVTGFKAGDRVVALRPGQGAHRSLVRNPASWCYKLPESMSFV
EAAAMPLILGTAWFALDHTARLARGETLLIHAAAGGVGQMAIQIAQGVGARILATVGSPAKRQLLKDTYGLADEQ
IFSSRNDLFVKGVMGATGGRGVDVVLNSLAGPLLHASWACLAPFGRFVEIGKRDIHENASISMDPFRRNVLFASI
DLVTMFEQNKPLGARLFKECFDLIASGKIKAPATIRQFSYAELVKGFRMLQMGRHTGKIVLVPHAEDMVPVLRSG
YRNTKLFSAEKTYLLVGGLGGLGRTLSQWMVRKGATKLAFLSRSGADKPEAKVTMQWLIERGISVGIYRGDVSQA
CHVAACVDSIGSSLGGLFQAAMVLHDKPLETMTHAQWQSCCLPKVEGTRNLHQATLGRKLDFFISFSSVACIVGS
KGQANYAAANCFLDALMRHRRQAGLVGTSINVGAVTGVGVVAENEELHKKLLRMGMDTINEQELLYQVEEAVLAN
GTLASLTPRGCTAHQIISGVGLVSPNIYWASKPMMKNLYVNHDFGGDGAADQTQKNLLAILKNEPEMDKRLALLL
DGFLDKIAEVLATPRESILASSPLSAYGLDSIVAVEFRKWFRNEVQVDIALFDILGAASINALVSKTVRMMAKSP
LAKETVVKSHAANDQTASRVEVEGPSDKTVNSAMASGELTKASAEGASPLSTFQSRLWFVHSFLDDKSLLNLPVV
LHMRGKPDHASLQTTLRELAWRNPVLRSAYFEGEECSMQQPMDDFELDLDYQDFSCISYASTEQQAKSSDQASKA
KQALLGELLQHKRLMEMNVDEGQVASFCLVKLSDLEWAMVAVAHHMSIDRGSLFPMMSQFVAIYDAVRAKTDLAF
VAAPEFDYVDFTLWHNARLASDLMKPDLEWWRRTLEGVAQSSKLLPFARFEQRPARGEPQREKVRTTIEANMFAR
MKRISAQSGATPFHFVLAAFRAFIYRYTEEKDVVLLMVDGNRPHPDTESLVGFFVNLAPVRCNDDCDVPFDQLFQ
ATKRRALDAMAHSGVPFDTIVDIVKAQKTSSHMPLGQIAVNYQIHGPAPAYQTVDFVVDDITSSDIPTAAEMQLE
AIETSQHCLDLKIEYATLLYSDADMERFVDNFGVFLTNCIRDHRQPVDEIAMCGPLEMDLLGSRYWNTQTRENQW
QRRSVLDVIASQQPLAVAINTSDGDAMSYQELMQNASSLAAALLDAGLVPGQCIGVVALPGVEAIVAVLGILMLG
ACYVALDVDFAEDRLAFMVKDSRAAALVVGKEHEGLAARLAAKSVGGAPVVLRVDEACARAGCLARQRPRQPQDP
FYMIYTSGSTGTPKGVVLSEANTQAMLASLNKHLDFGHTDVFLAHTTMAFDLSVVQIFGALTAGATVSLASWETR
KDPAALARFMEQQGVSVTYFTPTQYSLLVEANSGALRRCSKYRVALFAGERLPVRLVRAFFHLGLGASLYNTWAP
SELVVQTTLAKIDAPPQGVVSLPIGYPLDNCRHYIVDARGEPVPCGHVGELVVGGAQVGVGYLHRPELNAQFFVR
NVFASDDDCRRGWTRMFKTGDRGRFRPDGQLEFHGRIAGDKQIKLRGFRLDLGEVEHVLFRESQLLYTGALADIA
VVARTVESGDTQLVAFILLRDKMVQGAAKAAVVSRLHQSVKPHLNHYMLPSGYQFIDQLPLTIGGKVNRRELLER
RLDLVYPSSVTTRLKESHAADLSEACAPAVDHLDKSVIALFQTVLGGVQVRLHDSFFDRGGNSILLIRLHAKIKR
KFKLAPPLPALIRQPTAAAVCAYIRSGGGTADVQSNRAMINWKTETNLPNMSQYMPHFDALSLVQNFAEFGAVLL
TGAETFIGVHVLAALLRNKADVTVHVVGSMQRLEFAPLLHLLAKHQLLDQDGLDADQVTRRVCLVPGALSEPNLG
LSRSAFGSLGAAVDAIYHLGGHVSLLKPYSALRRLNVAPVLDMIRLAGCGRRVSALHYLSTWSVAHLQTWTGATR
TRDDYVTAEEPCTHFTPPTDDAAGYFKTRWVAESLLVEAARRGFPVTIVRASAVTAARADGGAAGDVLDPADELT
MRMVVDMVDSGTVPSIGRDDQPGFAIDVVPVDWLAESLVALTTRSRHKAACPSTAAAASSSPTPSLHIFHLSNPQ
PLALRRLPLIIAQLRPGHGQLISLSEWLATMAAQGQDDASQRARNEAVRQTLETGSVMFSLQNTWTMGVLEEQRP
GLVAKCPAVDAVFLKALWERMGRG*
Coding >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGACAAATGCGCGATATGGATACTTTTTAGAC
CAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGCCGAGGCTATGGATCCGCAGCAG
CGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCTGGATGAGATTCGGGGGTCTCTA
ACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAAGGATCTCGAGTCATATCCCAAG
TACACGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCATACTTTTACGACCTCCACGGCACAAGC
GTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTGGCAGCCAGACACTGCAGAATGGCGAG
GCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACGTCTTCATCACCATGACGGACCTGGGG
ATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCGGCTACGTACGCGGCGAGGGGATTGCC
TGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGGTGCGGGCCGTGGTGCGGGCCACGGGC
ACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCGGCGCGGCGCAGGAGCGGCTGATTCGC
GAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTGAGGCGCATGGCACGGGCACGGCGGCG
GGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGAGGAGAGGAGTGCTGTGGATGGGGTCG
GTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCATCATCAAGACGACGCTGGCGTTGGAA
AAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGATTGATTTTGCTGGTTGCAGGCTGGCG
GTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGCGGGCGAGTATTAATTCGTTTGGCTAT
GGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCCAAGTGGCGGCAGAGGCTCTGGAGCCG
GGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACTCGCCCAAGGCGGGTGAGCTAACGGAA
AAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCAGCCTGGCGCACAGTCTGTCGACGCGG
CGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAAGTGTTGCCGAGCAGCTCTGCTCAGCC
AGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTGGCTTCGTCTTTACCGGGCAGGGCGCG
CAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTACGCAGACACTGGAGCGATGCGACGCG
CTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGCTGGAGAGGCCGCTCGACGCGTGCCGG
CTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGGCGCTTGTGGACTTGCTTGCGTGCTGG
GGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGGCGGCGTATGCAGCTGGGATACTCAGC
CTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGGCCTCGGGAGAGGATTCGGCCAGGGGA
GGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGGAGGCGTTTGCTGGGCGGCTGGTGCTG
GCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACGCCCTGACGGAGCTGGGAGATTTGTTG
CTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTCACTCGCACCACATGGTTCCGCTGGCG
CCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAGCGTGTGTGGCGCAGTGTCGCATGTTT
TCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGTACTGGGCTGCCAACATGGTGCAGCCG
GTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACGAGCAAAATGTGGATGTCTTGGTTGAG
ATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGGCGCTGAGGCTTGACTTGCCGTATATT
GGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGGCTGGCACGCTCTTTTGTCTCGGCTGC
GCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACGGATCCCTCGTGCAGACGGCAACGGGC
TCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACTGGGCCGAGACGCGAGTTATTCGGGAG
CACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGGGCTCGGTGGCGCGGCGGCCGCGTTTT
CGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGGTTGAAAACAAGGCGGTGTTTCCGGGC
GCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGCTGGACGGGGTGGAAATGGTGCAGGTC
AAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGGGCGTCGAGGTTGTTGTCGAGCTGGAG
CCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTGAAGTCTTTTCGTACGATGATGGTTCA
AATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAGCTGCGCCGCTTGACGCTTCTTGCTTG
ACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGAAAAGAACGTGGCGGTCGGTGCCGGCT
CACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACTGCTTCCGTCTCCTAAGGGGAAGCATA
GAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCGTCTTGCCGAGCGAGGCGGGCGATGAA
ACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTCTCGCTATACAGGAGCGGCTGGGACGC
CCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCTCGGGCAGGTTTTTTGATTTGAGGCAC
GACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCTCGCCGCGCGTTGCCATGAGCAGCCTG
TTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGGAGCTCACCTCGCTGGGCCGCCATGTT
GTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGCCGTGCTTTGACTTGTTGCCAGACGGA
CAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATCCCAATGCGTCCATGTTGTATATTGCA
GCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGCAGGGCGAGCGGCGTCGTTTGAAGCAC
ATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGGCGGAGGAGCTGTGCAAGACGTCAAGA
GGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCGTTATTGTTAACGAGGCGGTGTCGGAT
GCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGGCCGTCGATTCTTGCACTGCGTCGGGT
CTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGTCTGATGCCTATAGTGCGCCTACAGAG
CTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGATTCTGGAAGCGCTGCACGCTGCATAC
CCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCGCCAGCCCGTGCAGCAACGTCATTGTC
CTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCGCCCAGCGCCTGCTCACGTCGGTGCAA
AAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGCCCGAGAGCGCCATCTATCTCGGACTG
GTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTGACTTTGCCGCCGAGTCGCCAGCCTCG
TCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGGGAGAGGTGGCGGAGCAAGAGGGCATC
ATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGACAAACGGACCGAACCAAGAGCCGCGG
CTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCATTGGCAAGGTTGGACTGTTGGAAACG
CTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACGAGGATGTCGAGGTGGAAACACGGGCT
TCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGGACTCGGAGCTTGGCGACGAATGCGCG
GGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGGACCGCGTCGTTGCTCTGCGGCCGGGC
CAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACAAGCTGCCAGAGAGCATGTCTTTTGTT
GAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTGACCACACTGCTCGGTTGGCCAGAGGG
GAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCATTCAGATTGCCCAGGGCGTGGGTGCG
CGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGGACACGTATGGGCTGGCCGATGAGCAG
ATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGACGGGCGGGCGCGGTGTGGATGTGGTG
CTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGGCGCCCTTTGGCCGCTTTGTCGAGATT
GGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTAGACGCAACGTGCTCTTTGCCTCGATT
GACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCTTCAAGGAGTGTTTTGACCTTATTGCC
AGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCGAGCTTGTAAAGGGCTTTCGAATGCTG
CAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGGACATGGTGCCCGTGCTGCGCAGCGGC
TACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTGGTGGGCTTGGCGGGCTGGGACGGACT
CTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGTCTCGCTCTGGCGCTGACAAGCCCGAG
GCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCATCTACCGCGGAGACGTTTCCCAAGCA
TGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCCTTTTCCAAGCCGCCATGGTGCTGCAC
GACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTCTGCCCAAGGTTGAGGGCACGCGCAAC
CTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCTCCTCTGTAGCCTGCATCGTCGGGTCC
AAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGATGCGCCATCGCAGGCAAGCAGGGCTG
GTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTGCCGAGAACGAGGAGCTGCATAAGAAG
CTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACCAGGTGGAGGAGGCAGTCTTGGCTAAT
GGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTATTAGCGGCGTGGGCCTCGTCTCTCCA
AATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACCACGACTTTGGCGGGGATGGGGCCGCC
GACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAATGGACAAGAGGCTGGCGCTGCTGCTG
GACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGTCCATCTTGGCCAGCAGTCCGTTATCG
GCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCCGCAACGAGGTGCAGGTTGACATTGCC
CTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAACGGTACGAATGATGGCCAAGAGCCCA
TTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGGCGAGCCGGGTGGAGGTGGAGGGCCCC
AGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGGCGAGTGCGGAGGGCGCCAGTCCCCTG
TCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACAAGTCGCTGCTTAACCTGCCCGTGGTG
CTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGCGGGAGCTGGCGTGGCGGAATCCGGTG
CTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCATGGACGACTTTGAGCTCGACCTCGAC
TACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCAAGTCGAGCGACCAGGCAAGCAAGGCA
AAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGATGAATGTCGACGAGGGCCAAGTAGCC
AGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGGTGGCACACCACATGTCGATTGACCGG
GGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGGTGCGGGCCAAGACGGACCTGGCCTTT
GTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATGCGCGGCTGGCGTCGGACCTGATGAAG
CCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTAGCAAGCTGTTGCCCTTTGCGCGCTTT
GAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGACAATCGAGGCCAACATGTTTGCTCGC
ATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCCTGGCGGCCTTTCGCGCCTTTATCTAT
CGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACCGGCCGCATCCAGACACTGAGTCGCTA
GTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGACGACTGCGACGTGCCATTTGACCAGTTATTCCAA
GCCACCAAGCGGCGCGCTCTCGACGCCATGGCCCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAG
GCGCAAAAGACGAGCAGCCACATGCCGCTCGGCCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCC
TACCAGACAGTCGACTTTGTCGTTGACGACATTACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAG
GCCATTGAGACGTCGCAGCACTGTCTAGACCTCAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATG
GAGCGCTTCGTGGACAACTTTGGCGTCTTTTTGACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATT
GCCATGTGTGGGCCGCTAGAGATGGACTTGTTGGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGG
CAGCGGCGCAGCGTGCTCGACGTGATTGCCAGCCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGAC
GCCATGTCGTACCAAGAACTCATGCAAAATGCATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCG
GGGCAGTGCATCGGAGTAGTAGCTCTGCCGGGCGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGC
GCGTGCTACGTTGCGCTTGATGTCGACTTTGCAGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCG
GCTCTAGTCGTGGGCAAGGAGCATGAGGGGCTGGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTC
GTGCTGAGGGTTGATGAGGCGTGTGCTCGAGCCGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCC
TTTTACATGATTTACACATCGGGAAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCC
ATGCTTGCTTCGCTCAACAAGCATCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTT
GACCTTTCCGTCGTGCAAATCTTTGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGC
AAGGACCCTGCTGCTCTGGCCCGCTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTAC
TCTCTCCTCGTCGAAGCCAACTCTGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAG
CGGCTTCCCGTTCGTCTGGTTAGGGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCC
TCTGAACTCGTGGTGCAGACGACGCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGC
TATCCCTTGGATAACTGCCGTCACTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAG
CTGGTTGTTGGCGGAGCTCAAGTCGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGC
AATGTCTTTGCCTCGGACGACGATTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTT
CGTCCCGACGGACAGCTCGAGTTTCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTT
GATTTGGGCGAGGTGGAGCACGTCTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCC
GTTGTGGCGCGCACTGTCGAGTCTGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAA
GGCGCGGCCAAGGCGGCTGTCGTTTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCC
AGCGGCTATCAGTTTATTGACCAGTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGT
CGGCTGGACCTGGTTTACCCTTCATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCT
TGTGCGCCAGCCGTCGATCATCTCGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTG
CGCCTGCACGACTCCTTCTTTGACCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGC
AAATTCAAGCTTGCTCCCCCGCTGCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGC
AGCGGAGGCGGCACAGCAGATGTGCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAAC
ATGAGCCAGTACATGCCGCACTTTGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTG
ACGGGAGCAGAGACATTTATAGGTGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCAT
GTCGTGGGCTCCATGCAAAGACTCGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAA
GACGGTCTCGACGCAGACCAGGTAACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGC
CTCTCACGGTCCGCCTTTGGCAGCCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTC
CTAAAGCCCTACTCGGCGCTGCGGCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGG
CGACGCGTCTCAGCGCTGCACTACCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGA
ACGCGTGACGACTATGTGACAGCCGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTAC
TTCAAGACGCGGTGGGTGGCTGAGAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGC
GCGTCGGCAGTGACTGCGGCCCGGGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACG
ATGCGCATGGTGGTGGACATGGTTGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCC
ATTGATGTGGTTCCTGTCGACTGGCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCT
TGTCCCTCTACCGCTGCTGCGGCATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAG
CCCCTTGCGCTACGACGTCTTCCTCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGC
GAGTGGCTTGCAACCATGGCAGCCCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAG
ACGCTCGAGACGGGTTCCGTCATGTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCG
GGGCTGGTGGCAAAGTGTCCTGCAGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG
Transcript >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGACAAATGCGCGATATGGATACTTTTTAGAC
CAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGCCGAGGCTATGGATCCGCAGCAG
CGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCTGGATGAGATTCGGGGGTCTCTA
ACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAAGGATCTCGAGTCATATCCCAAG
TACACGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCATACTTTTACGACCTCCACGGCACAAGC
GTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTGGCAGCCAGACACTGCAGAATGGCGAG
GCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACGTCTTCATCACCATGACGGACCTGGGG
ATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCGGCTACGTACGCGGCGAGGGGATTGCC
TGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGGTGCGGGCCGTGGTGCGGGCCACGGGC
ACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCGGCGCGGCGCAGGAGCGGCTGATTCGC
GAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTGAGGCGCATGGCACGGGCACGGCGGCG
GGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGAGGAGAGGAGTGCTGTGGATGGGGTCG
GTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCATCATCAAGACGACGCTGGCGTTGGAA
AAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGATTGATTTTGCTGGTTGCAGGCTGGCG
GTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGCGGGCGAGTATTAATTCGTTTGGCTAT
GGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCCAAGTGGCGGCAGAGGCTCTGGAGCCG
GGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACTCGCCCAAGGCGGGTGAGCTAACGGAA
AAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCAGCCTGGCGCACAGTCTGTCGACGCGG
CGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAAGTGTTGCCGAGCAGCTCTGCTCAGCC
AGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTGGCTTCGTCTTTACCGGGCAGGGCGCG
CAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTACGCAGACACTGGAGCGATGCGACGCG
CTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGCTGGAGAGGCCGCTCGACGCGTGCCGG
CTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGGCGCTTGTGGACTTGCTTGCGTGCTGG
GGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGGCGGCGTATGCAGCTGGGATACTCAGC
CTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGGCCTCGGGAGAGGATTCGGCCAGGGGA
GGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGGAGGCGTTTGCTGGGCGGCTGGTGCTG
GCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACGCCCTGACGGAGCTGGGAGATTTGTTG
CTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTCACTCGCACCACATGGTTCCGCTGGCG
CCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAGCGTGTGTGGCGCAGTGTCGCATGTTT
TCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGTACTGGGCTGCCAACATGGTGCAGCCG
GTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACGAGCAAAATGTGGATGTCTTGGTTGAG
ATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGGCGCTGAGGCTTGACTTGCCGTATATT
GGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGGCTGGCACGCTCTTTTGTCTCGGCTGC
GCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACGGATCCCTCGTGCAGACGGCAACGGGC
TCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACTGGGCCGAGACGCGAGTTATTCGGGAG
CACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGGGCTCGGTGGCGCGGCGGCCGCGTTTT
CGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGGTTGAAAACAAGGCGGTGTTTCCGGGC
GCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGCTGGACGGGGTGGAAATGGTGCAGGTC
AAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGGGCGTCGAGGTTGTTGTCGAGCTGGAG
CCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTGAAGTCTTTTCGTACGATGATGGTTCA
AATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAGCTGCGCCGCTTGACGCTTCTTGCTTG
ACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGAAAAGAACGTGGCGGTCGGTGCCGGCT
CACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACTGCTTCCGTCTCCTAAGGGGAAGCATA
GAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCGTCTTGCCGAGCGAGGCGGGCGATGAA
ACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTCTCGCTATACAGGAGCGGCTGGGACGC
CCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCTCGGGCAGGTTTTTTGATTTGAGGCAC
GACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCTCGCCGCGCGTTGCCATGAGCAGCCTG
TTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGGAGCTCACCTCGCTGGGCCGCCATGTT
GTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGCCGTGCTTTGACTTGTTGCCAGACGGA
CAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATCCCAATGCGTCCATGTTGTATATTGCA
GCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGCAGGGCGAGCGGCGTCGTTTGAAGCAC
ATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGGCGGAGGAGCTGTGCAAGACGTCAAGA
GGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCGTTATTGTTAACGAGGCGGTGTCGGAT
GCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGGCCGTCGATTCTTGCACTGCGTCGGGT
CTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGTCTGATGCCTATAGTGCGCCTACAGAG
CTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGATTCTGGAAGCGCTGCACGCTGCATAC
CCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCGCCAGCCCGTGCAGCAACGTCATTGTC
CTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCGCCCAGCGCCTGCTCACGTCGGTGCAA
AAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGCCCGAGAGCGCCATCTATCTCGGACTG
GTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTGACTTTGCCGCCGAGTCGCCAGCCTCG
TCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGGGAGAGGTGGCGGAGCAAGAGGGCATC
ATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGACAAACGGACCGAACCAAGAGCCGCGG
CTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCATTGGCAAGGTTGGACTGTTGGAAACG
CTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACGAGGATGTCGAGGTGGAAACACGGGCT
TCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGGACTCGGAGCTTGGCGACGAATGCGCG
GGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGGACCGCGTCGTTGCTCTGCGGCCGGGC
CAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACAAGCTGCCAGAGAGCATGTCTTTTGTT
GAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTGACCACACTGCTCGGTTGGCCAGAGGG
GAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCATTCAGATTGCCCAGGGCGTGGGTGCG
CGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGGACACGTATGGGCTGGCCGATGAGCAG
ATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGACGGGCGGGCGCGGTGTGGATGTGGTG
CTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGGCGCCCTTTGGCCGCTTTGTCGAGATT
GGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTAGACGCAACGTGCTCTTTGCCTCGATT
GACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCTTCAAGGAGTGTTTTGACCTTATTGCC
AGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCGAGCTTGTAAAGGGCTTTCGAATGCTG
CAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGGACATGGTGCCCGTGCTGCGCAGCGGC
TACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTGGTGGGCTTGGCGGGCTGGGACGGACT
CTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGTCTCGCTCTGGCGCTGACAAGCCCGAG
GCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCATCTACCGCGGAGACGTTTCCCAAGCA
TGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCCTTTTCCAAGCCGCCATGGTGCTGCAC
GACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTCTGCCCAAGGTTGAGGGCACGCGCAAC
CTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCTCCTCTGTAGCCTGCATCGTCGGGTCC
AAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGATGCGCCATCGCAGGCAAGCAGGGCTG
GTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTGCCGAGAACGAGGAGCTGCATAAGAAG
CTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACCAGGTGGAGGAGGCAGTCTTGGCTAAT
GGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTATTAGCGGCGTGGGCCTCGTCTCTCCA
AATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACCACGACTTTGGCGGGGATGGGGCCGCC
GACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAATGGACAAGAGGCTGGCGCTGCTGCTG
GACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGTCCATCTTGGCCAGCAGTCCGTTATCG
GCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCCGCAACGAGGTGCAGGTTGACATTGCC
CTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAACGGTACGAATGATGGCCAAGAGCCCA
TTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGGCGAGCCGGGTGGAGGTGGAGGGCCCC
AGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGGCGAGTGCGGAGGGCGCCAGTCCCCTG
TCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACAAGTCGCTGCTTAACCTGCCCGTGGTG
CTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGCGGGAGCTGGCGTGGCGGAATCCGGTG
CTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCATGGACGACTTTGAGCTCGACCTCGAC
TACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCAAGTCGAGCGACCAGGCAAGCAAGGCA
AAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGATGAATGTCGACGAGGGCCAAGTAGCC
AGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGGTGGCACACCACATGTCGATTGACCGG
GGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGGTGCGGGCCAAGACGGACCTGGCCTTT
GTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATGCGCGGCTGGCGTCGGACCTGATGAAG
CCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTAGCAAGCTGTTGCCCTTTGCGCGCTTT
GAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGACAATCGAGGCCAACATGTTTGCTCGC
ATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCCTGGCGGCCTTTCGCGCCTTTATCTAT
CGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACCGGCCGCATCCAGACACTGAGTCGCTA
GTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGACGACTGCGACGTGCCATTTGACCAGTTATTCCAA
GCCACCAAGCGGCGCGCTCTCGACGCCATGGCCCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAG
GCGCAAAAGACGAGCAGCCACATGCCGCTCGGCCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCC
TACCAGACAGTCGACTTTGTCGTTGACGACATTACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAG
GCCATTGAGACGTCGCAGCACTGTCTAGACCTCAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATG
GAGCGCTTCGTGGACAACTTTGGCGTCTTTTTGACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATT
GCCATGTGTGGGCCGCTAGAGATGGACTTGTTGGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGG
CAGCGGCGCAGCGTGCTCGACGTGATTGCCAGCCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGAC
GCCATGTCGTACCAAGAACTCATGCAAAATGCATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCG
GGGCAGTGCATCGGAGTAGTAGCTCTGCCGGGCGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGC
GCGTGCTACGTTGCGCTTGATGTCGACTTTGCAGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCG
GCTCTAGTCGTGGGCAAGGAGCATGAGGGGCTGGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTC
GTGCTGAGGGTTGATGAGGCGTGTGCTCGAGCCGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCC
TTTTACATGATTTACACATCGGGAAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCC
ATGCTTGCTTCGCTCAACAAGCATCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTT
GACCTTTCCGTCGTGCAAATCTTTGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGC
AAGGACCCTGCTGCTCTGGCCCGCTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTAC
TCTCTCCTCGTCGAAGCCAACTCTGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAG
CGGCTTCCCGTTCGTCTGGTTAGGGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCC
TCTGAACTCGTGGTGCAGACGACGCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGC
TATCCCTTGGATAACTGCCGTCACTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAG
CTGGTTGTTGGCGGAGCTCAAGTCGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGC
AATGTCTTTGCCTCGGACGACGATTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTT
CGTCCCGACGGACAGCTCGAGTTTCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTT
GATTTGGGCGAGGTGGAGCACGTCTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCC
GTTGTGGCGCGCACTGTCGAGTCTGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAA
GGCGCGGCCAAGGCGGCTGTCGTTTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCC
AGCGGCTATCAGTTTATTGACCAGTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGT
CGGCTGGACCTGGTTTACCCTTCATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCT
TGTGCGCCAGCCGTCGATCATCTCGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTG
CGCCTGCACGACTCCTTCTTTGACCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGC
AAATTCAAGCTTGCTCCCCCGCTGCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGC
AGCGGAGGCGGCACAGCAGATGTGCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAAC
ATGAGCCAGTACATGCCGCACTTTGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTG
ACGGGAGCAGAGACATTTATAGGTGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCAT
GTCGTGGGCTCCATGCAAAGACTCGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAA
GACGGTCTCGACGCAGACCAGGTAACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGC
CTCTCACGGTCCGCCTTTGGCAGCCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTC
CTAAAGCCCTACTCGGCGCTGCGGCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGG
CGACGCGTCTCAGCGCTGCACTACCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGA
ACGCGTGACGACTATGTGACAGCCGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTAC
TTCAAGACGCGGTGGGTGGCTGAGAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGC
GCGTCGGCAGTGACTGCGGCCCGGGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACG
ATGCGCATGGTGGTGGACATGGTTGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCC
ATTGATGTGGTTCCTGTCGACTGGCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCT
TGTCCCTCTACCGCTGCTGCGGCATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAG
CCCCTTGCGCTACGACGTCTTCCTCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGC
GAGTGGCTTGCAACCATGGCAGCCCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAG
ACGCTCGAGACGGGTTCCGTCATGTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCG
GGGCTGGTGGCAAAGTGTCCTGCAGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG
Gene >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGGTGAGTTGGTTATATATCTCTGCCCATTTT
ACGCATCTTGCCTTGCTTTTTTCAAAAAAGGGGTGGTTTTTGTTTTTTGGCTAACGTGGAGGTGTAGACAAATGC
GCGATATGGATACTTTTTAGACCAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGC
CGAGGCTATGGATCCGCAGCAGCGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCT
GGATGAGATTCGGGGGTCTCTAACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAA
GGATCTCGAGTCATATCCCAAGTACACGGTGAGTTGGGCATGATGCTGGGAGGGAATCAGAGCTTGCTTTCTAAC
GCGTTGTTTATTCTTGGGTTGGGGGTGAGCAGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCAT
ACTTTTACGACCTCCACGGCACAAGCGTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTG
GCAGCCAGACACTGCAGAATGGCGAGGCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACG
TCTTCATCACCATGACGGACCTGGGGATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCG
GCTACGTACGCGGCGAGGGGATTGCCTGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGG
TGCGGGCCGTGGTGCGGGCCACGGGCACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCG
GCGCGGCGCAGGAGCGGCTGATTCGCGAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTG
AGGCGCATGGCACGGGCACGGCGGCGGGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGA
GGAGAGGAGTGCTGTGGATGGGGTCGGTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCA
TCATCAAGACGACGCTGGCGTTGGAAAAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGA
TTGATTTTGCTGGTTGCAGGCTGGCGGTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGC
GGGCGAGTATTAATTCGTTTGGCTATGGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCC
AAGTGGCGGCAGAGGCTCTGGAGCCGGGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACT
CGCCCAAGGCGGGTGAGCTAACGGAAAAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCA
GCCTGGCGCACAGTCTGTCGACGCGGCGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAA
GTGTTGCCGAGCAGCTCTGCTCAGCCAGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTG
GCTTCGTCTTTACCGGGCAGGGCGCGCAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTA
CGCAGACACTGGAGCGATGCGACGCGCTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGC
TGGAGAGGCCGCTCGACGCGTGCCGGCTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGG
CGCTTGTGGACTTGCTTGCGTGCTGGGGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGG
CGGCGTATGCAGCTGGGATACTCAGCCTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGG
CCTCGGGAGAGGATTCGGCCAGGGGAGGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGG
AGGCGTTTGCTGGGCGGCTGGTGCTGGCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACG
CCCTGACGGAGCTGGGAGATTTGTTGCTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTC
ACTCGCACCACATGGTTCCGCTGGCGCCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAG
CGTGTGTGGCGCAGTGTCGCATGTTTTCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGT
ACTGGGCTGCCAACATGGTGCAGCCGGTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACG
AGCAAAATGTGGATGTCTTGGTTGAGATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGG
CGCTGAGGCTTGACTTGCCGTATATTGGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGG
CTGGCACGCTCTTTTGTCTCGGCTGCGCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACG
GATCCCTCGTGCAGACGGCAACGGGCTCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACT
GGGCCGAGACGCGAGTTATTCGGGAGCACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGG
GCTCGGTGGCGCGGCGGCCGCGTTTTCGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGG
TTGAAAACAAGGCGGTGTTTCCGGGCGCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGC
TGGACGGGGTGGAAATGGTGCAGGTCAAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGG
GCGTCGAGGTTGTTGTCGAGCTGGAGCCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTG
AAGTCTTTTCGTACGATGATGGTTCAAATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAG
CTGCGCCGCTTGACGCTTCTTGCTTGACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGA
AAAGAACGTGGCGGTCGGTGCCGGCTCACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACT
GCTTCCGTCTCCTAAGGGGAAGCATAGAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCG
TCTTGCCGAGCGAGGCGGGCGATGAAACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTC
TCGCTATACAGGAGCGGCTGGGACGCCCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCT
CGGGCAGGTTTTTTGATTTGAGGCACGACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCT
CGCCGCGCGTTGCCATGAGCAGCCTGTTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGG
AGCTCACCTCGCTGGGCCGCCATGTTGTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGC
CGTGCTTTGACTTGTTGCCAGACGGACAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATC
CCAATGCGTCCATGTTGTATATTGCAGCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGC
AGGGCGAGCGGCGTCGTTTGAAGCACATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGG
CGGAGGAGCTGTGCAAGACGTCAAGAGGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCG
TTATTGTTAACGAGGCGGTGTCGGATGCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGG
CCGTCGATTCTTGCACTGCGTCGGGTCTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGT
CTGATGCCTATAGTGCGCCTACAGAGCTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGA
TTCTGGAAGCGCTGCACGCTGCATACCCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCG
CCAGCCCGTGCAGCAACGTCATTGTCCTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCG
CCCAGCGCCTGCTCACGTCGGTGCAAAAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGC
CCGAGAGCGCCATCTATCTCGGACTGGTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTG
ACTTTGCCGCCGAGTCGCCAGCCTCGTCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGG
GAGAGGTGGCGGAGCAAGAGGGCATCATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGA
CAAACGGACCGAACCAAGAGCCGCGGCTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCA
TTGGCAAGGTTGGACTGTTGGAAACGCTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACG
AGGATGTCGAGGTGGAAACACGGGCTTCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGG
ACTCGGAGCTTGGCGACGAATGCGCGGGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGG
ACCGCGTCGTTGCTCTGCGGCCGGGCCAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACA
AGCTGCCAGAGAGCATGTCTTTTGTTGAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTG
ACCACACTGCTCGGTTGGCCAGAGGGGAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCA
TTCAGATTGCCCAGGGCGTGGGTGCGCGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGG
ACACGTATGGGCTGGCCGATGAGCAGATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGA
CGGGCGGGCGCGGTGTGGATGTGGTGCTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGG
CGCCCTTTGGCCGCTTTGTCGAGATTGGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTA
GACGCAACGTGCTCTTTGCCTCGATTGACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCT
TCAAGGAGTGTTTTGACCTTATTGCCAGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCG
AGCTTGTAAAGGGCTTTCGAATGCTGCAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGG
ACATGGTGCCCGTGCTGCGCAGCGGCTACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTG
GTGGGCTTGGCGGGCTGGGACGGACTCTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGT
CTCGCTCTGGCGCTGACAAGCCCGAGGCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCA
TCTACCGCGGAGACGTTTCCCAAGCATGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCC
TTTTCCAAGCCGCCATGGTGCTGCACGACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTC
TGCCCAAGGTTGAGGGCACGCGCAACCTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCT
CCTCTGTAGCCTGCATCGTCGGGTCCAAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGA
TGCGCCATCGCAGGCAAGCAGGGCTGGTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTG
CCGAGAACGAGGAGCTGCATAAGAAGCTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACC
AGGTGGAGGAGGCAGTCTTGGCTAATGGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTA
TTAGCGGCGTGGGCCTCGTCTCTCCAAATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACC
ACGACTTTGGCGGGGATGGGGCCGCCGACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAA
TGGACAAGAGGCTGGCGCTGCTGCTGGACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGT
CCATCTTGGCCAGCAGTCCGTTATCGGCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCC
GCAACGAGGTGCAGGTTGACATTGCCCTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAA
CGGTACGAATGATGGCCAAGAGCCCATTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGG
CGAGCCGGGTGGAGGTGGAGGGCCCCAGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGG
CGAGTGCGGAGGGCGCCAGTCCCCTGTCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACA
AGTCGCTGCTTAACCTGCCCGTGGTGCTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGC
GGGAGCTGGCGTGGCGGAATCCGGTGCTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCA
TGGACGACTTTGAGCTCGACCTCGACTACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCA
AGTCGAGCGACCAGGCAAGCAAGGCAAAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGA
TGAATGTCGACGAGGGCCAAGTAGCCAGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGG
TGGCACACCACATGTCGATTGACCGGGGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGG
TGCGGGCCAAGACGGACCTGGCCTTTGTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATG
CGCGGCTGGCGTCGGACCTGATGAAGCCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTA
GCAAGCTGTTGCCCTTTGCGCGCTTTGAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGA
CAATCGAGGCCAACATGTTTGCTCGCATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCC
TGGCGGCCTTTCGCGCCTTTATCTATCGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACC
GGCCGCATCCAGACACTGAGTCGCTAGTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGGTGTGTGTG
TGTGTTTTTTTTTTTTTTTTTTTTTTTTCATGGAGTTCTAAGCAAGTGAGTGGTTTGATGCTAATGATGGGTCAA
AAAAATAGACGACTGCGACGTGCCATTTGACCAGTTATTCCAAGCCACCAAGCGGCGCGCTCTCGACGCCATGGC
CCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAGGCGCAAAAGACGAGCAGCCACATGCCGCTCGG
CCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCCTACCAGACAGTCGACTTTGTCGTTGACGACAT
TACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAGGCCATTGAGACGTCGCAGCACTGTCTAGACCT
CAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATGGAGCGCTTCGTGGACAACTTTGGCGTCTTTTT
GACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATTGCCATGTGTGGGCCGCTAGAGATGGACTTGTT
GGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGGCAGCGGCGCAGCGTGCTCGACGTGATTGCCAG
CCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGACGCCATGTCGTACCAAGAACTCATGCAAAATGC
ATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCGGGGCAGTGCATCGGAGTAGTAGCTCTGCCGGG
CGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGCGCGTGCTACGTTGCGCTTGATGTCGACTTTGC
AGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCGGCTCTAGTCGTGGGCAAGGAGCATGAGGGGCT
GGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTCGTGCTGAGGGTTGATGAGGCGTGTGCTCGAGC
CGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCCTTTTACATGATTTACACATCGGTGAGTCTGTT
TTTGAAAATAGAAATGGAGCGTTTCAAGTTGAAAGCAGCTGACATGATTTTTTCTTCTTCTTCTTTCCTGCAGGG
AAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCCATGCTTGCTTCGCTCAACAAGCA
TCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTTGACCTTTCCGTCGTGCAAATCTT
TGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGCAAGGACCCTGCTGCTCTGGCCCG
CTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTACTCTCTCCTCGTCGAAGCCAACTC
TGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAGCGGCTTCCCGTTCGTCTGGTTAG
GGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCCTCTGAACTCGTGGTGCAGACGAC
GCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGCTATCCCTTGGATAACTGCCGTCA
CTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAGCTGGTTGTTGGCGGAGCTCAAGT
CGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGCAATGTCTTTGCCTCGGACGACGA
TTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTTCGTCCCGACGGACAGCTCGAGTT
TCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTTGATTTGGGCGAGGTGGAGCACGT
CTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCCGTTGTGGCGCGCACTGTCGAGTC
TGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAAGGCGCGGCCAAGGCGGCTGTCGT
TTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCCAGCGGCTATCAGTTTATTGACCA
GTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGTCGGCTGGACCTGGTTTACCCTTC
ATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCTTGTGCGCCAGCCGTCGATCATCT
CGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTGCGCCTGCACGACTCCTTCTTTGA
CCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGCAAATTCAAGCTTGCTCCCCCGCT
GCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGCAGCGGAGGCGGCACAGCAGATGT
GCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAACATGAGCCAGTACATGCCGCACTT
TGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTGACGGGAGCAGAGACATTTATAGG
TGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCATGTCGTGGGCTCCATGCAAAGACT
CGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAAGACGGTCTCGACGCAGACCAGGT
AACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGCCTCTCACGGTCCGCCTTTGGCAG
CCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTCCTAAAGCCCTACTCGGCGCTGCG
GCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGGCGACGCGTCTCAGCGCTGCACTA
CCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGAACGCGTGACGACTATGTGACAGC
CGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTACTTCAAGACGCGGTGGGTGGCTGA
GAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGCGCGTCGGCAGTGACTGCGGCCCG
GGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACGATGCGCATGGTGGTGGACATGGT
TGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCCATTGATGTGGTTCCTGTCGACTG
GCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCTTGTCCCTCTACCGCTGCTGCGGC
ATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAGCCCCTTGCGCTACGACGTCTTCC
TCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGCGAGTGGCTTGCAACCATGGCAGC
CCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAGACGCTCGAGACGGGTTCCGTCAT
GTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCGGGGCTGGTGGCAAAGTGTCCTGC
AGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail