Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5406
Gene name
LocationContig_41:46603..58730
Strand-
Gene length (bp)12127
Transcript length (bp)11775
Coding sequence length (bp)11775
Protein length (aa) 3925

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.3E-80 2860 3270
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.7E-74 12 260
PF00668 Condensation Condensation domain 2.0E-59 2371 2834
PF14765 PS-DH Polyketide synthase dehydratase 4.5E-57 933 1250
PF08659 KR KR domain 5.6E-56 1962 2136
PF00698 Acyl_transf_1 Acyl transferase domain 1.6E-53 543 860
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 4.3E-37 269 386
PF07993 NAD_binding_4 Male sterility protein 1.8E-34 3525 3786
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 8.5E-19 1797 1936
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.3E-19 388 511
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.2E-17 1761 1877
PF00550 PP-binding Phosphopantetheine attachment site 4.5E-07 2254 2314
PF00550 PP-binding Phosphopantetheine attachment site 3.5E-07 3412 3474
PF00106 adh_short short chain dehydrogenase 2.2E-07 1961 2136
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.9E-05 3287 3366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 8 1168 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1247 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 10 1274 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 10 1274 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1246 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 8 1168 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1247 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 10 1274 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 10 1274 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1246 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1955 3863 2.0E-160
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 9 917 2.0E-143
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 11 1171 2.0E-143
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 6 1176 4.0E-141
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 11 1172 5.0E-138
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 10 917 5.0E-137
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2366 3862 7.0E-134
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 15 1172 9.0E-134
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 917 2.0E-130
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 923 2.0E-130
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 9 1163 3.0E-128
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 11 1251 6.0E-128
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 11 1251 6.0E-128
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 11 1251 6.0E-128
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 9 1163 8.0E-126
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 12 986 2.0E-123
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 12 986 2.0E-123
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 11 832 3.0E-123
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 12 1243 1.0E-122
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 11 832 2.0E-122
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 920 3.0E-122
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 920 3.0E-122
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 920 3.0E-122
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 8 979 3.0E-121
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2374 3729 4.0E-121
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 11 832 7.0E-121
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 917 3.0E-120
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 917 7.0E-120
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 76 990 1.0E-118
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 917 2.0E-118
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 81 990 1.0E-117
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 15 1179 1.0E-116
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 81 990 1.0E-115
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 81 990 2.0E-115
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 3 990 5.0E-115
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 9 1165 8.0E-115
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 9 1165 8.0E-115
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 3 979 9.0E-115
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 11 1036 1.0E-114
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 8 984 2.0E-114
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 15 979 3.0E-114
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 15 980 1.0E-113
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 14 1012 3.0E-113
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 27 979 4.0E-113
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 81 1188 6.0E-113
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1495 2310 1.0E-112
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 15 979 1.0E-112
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 8 984 2.0E-112
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 11 1014 2.0E-112
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 9 979 4.0E-112
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 11 1014 1.0E-111
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 14 1014 1.0E-110
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2292 3450 3.0E-110
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 64 978 3.0E-110
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 64 978 8.0E-109
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 997 4.0E-108
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 10 979 7.0E-108
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 11 1014 1.0E-107
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2374 3444 5.0E-107
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2314 3447 1.0E-106
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 4 979 1.0E-105
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 15 1013 2.0E-105
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 15 1014 8.0E-105
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2356 3456 4.0E-104
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 76 980 5.0E-103
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 65 979 1.0E-102
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2356 3458 3.0E-102
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 80 979 4.0E-100
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2364 3475 4.0E-100
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 10 979 3.0E-99
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 11 434 3.0E-99
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 80 979 5.0E-99
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 919 1.0E-98
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 919 2.0E-98
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 919 2.0E-98
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2356 3456 1.0E-97
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 80 979 1.0E-97
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 80 979 1.0E-96
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 80 979 2.0E-96
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 2 979 4.0E-96
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2367 3477 9.0E-96
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 80 979 1.0E-95
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2367 3481 6.0E-95
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3478 8.0E-95
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2360 3492 2.0E-94
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 80 979 5.0E-94
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 80 979 1.0E-93
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2375 3474 4.0E-93
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3474 1.0E-92
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3474 2.0E-92
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2373 3474 3.0E-92
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 15 921 6.0E-92
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2363 3483 6.0E-91
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2367 3474 8.0E-91
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2367 3474 9.0E-91
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2277 3474 6.0E-90
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2374 3477 4.0E-89
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2364 3477 4.0E-89
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 10 513 8.0E-89
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2374 3477 2.0E-88
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 15 917 2.0E-88
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2369 3477 2.0E-88
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2375 3476 5.0E-88
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2360 3449 8.0E-88
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2379 3466 8.0E-88
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2503 3480 3.0E-87
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2375 3482 7.0E-87
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2374 3476 6.0E-86
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2364 3478 1.0E-85
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2364 3492 2.0E-85
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2293 3481 1.0E-84
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 15 917 1.0E-84
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2370 3478 3.0E-84
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2364 3481 4.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2370 3475 1.0E-83
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2344 3466 1.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2364 3476 4.0E-83
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2368 3450 9.0E-83
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2364 3482 3.0E-82
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2368 3474 3.0E-82
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2329 3476 2.0E-81
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2366 3476 2.0E-81
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2348 3482 3.0E-81
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2344 3476 1.0E-80
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2555 3476 3.0E-80
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2638 3474 4.0E-80
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2357 3482 4.0E-80
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2334 3476 8.0E-80
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2370 3474 1.0E-79
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2370 3488 2.0E-79
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 522 3.0E-79
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1524 2331 5.0E-79
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1524 2331 5.0E-79
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2352 3478 5.0E-79
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2476 3499 1.0E-78
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2344 3476 1.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2315 3476 3.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2476 3471 3.0E-78
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2374 3531 7.0E-78
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 522 1.0E-77
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2364 3477 3.0E-77
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2374 3320 3.0E-77
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 522 1.0E-76
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2364 3475 3.0E-76
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2364 3485 4.0E-76
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 522 1.0E-75
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2374 3516 2.0E-75
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2364 3475 5.0E-75
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 15 522 4.0E-74
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2374 3474 5.0E-74
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2374 3471 1.0E-73
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 10 427 3.0E-73
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2374 3477 6.0E-73
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 15 522 1.0E-72
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1518 2139 4.0E-72
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2364 3450 8.0E-72
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 15 562 2.0E-71
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2367 3476 3.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 592 9.0E-71
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2641 3521 2.0E-70
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2411 3470 3.0E-70
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 14 378 4.0E-69
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1651 2144 2.0E-68
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 11 522 3.0E-68
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1651 2361 6.0E-68
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1651 2143 7.0E-68
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2877 3482 1.0E-67
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 512 8.0E-67
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2877 3477 4.0E-65
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1524 2322 5.0E-65
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1524 2322 5.0E-65
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 523 6.0E-65
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1651 2143 4.0E-63
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2610 3504 4.0E-63
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2609 3790 2.0E-62
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1651 2141 6.0E-62
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1956 2743 2.0E-61
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1634 2316 5.0E-61
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2874 3449 1.0E-60
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2641 3790 5.0E-60
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1956 2743 1.0E-59
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2399 3474 4.0E-59
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1621 2167 8.0E-59
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2364 3477 3.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2408 3476 3.0E-58
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2861 3504 2.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2347 3474 2.0E-57
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2347 3474 2.0E-57
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2861 3504 2.0E-56
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2374 3477 4.0E-56
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 11 513 6.0E-56
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2850 3444 6.0E-56
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1599 2178 2.0E-54
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2877 3785 6.0E-54
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2864 3438 1.0E-53
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2864 3438 1.0E-53
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1654 2293 2.0E-53
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2823 3452 2.0E-53
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2823 3452 3.0E-53
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1635 2294 4.0E-53
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2823 3451 6.0E-53
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2355 3322 1.0E-52
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 15 522 2.0E-52
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2860 3449 5.0E-52
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1519 2293 5.0E-52
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2610 3790 2.0E-51
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1519 2293 3.0E-51
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2760 3476 3.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2777 3491 4.0E-51
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2784 3790 6.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2260 3479 3.0E-50
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 15 437 8.0E-50
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1643 2324 2.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2375 3470 7.0E-49
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2784 3455 2.0E-48
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2872 3377 2.0E-48
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 435 3.0E-48
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1639 2330 4.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2784 3455 5.0E-48
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2254 3484 5.0E-48
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2765 3507 2.0E-47
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2877 3482 4.0E-47
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2786 3469 8.0E-47
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2786 3469 1.0E-46
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2860 3450 1.0E-46
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2860 3450 1.0E-46
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2860 3450 1.0E-46
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2860 3370 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2764 3478 4.0E-46
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1644 2294 1.0E-45
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1639 2314 1.0E-45
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1638 2311 1.0E-45
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2258 3451 5.0E-45
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1644 2294 7.0E-45
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1644 2323 2.0E-44
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1586 2311 3.0E-43
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1627 2294 4.0E-43
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2915 3377 8.0E-43
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2614 3450 9.0E-43
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1638 2311 1.0E-42
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2719 3450 1.0E-42
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2547 3450 2.0E-42
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2633 3790 2.0E-42
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2868 3373 3.0E-42
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2877 3373 4.0E-42
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2868 3373 5.0E-42
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1556 2311 1.0E-41
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2868 3373 1.0E-41
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2868 3373 2.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2877 3384 3.0E-41
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2868 3373 4.0E-41
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2877 3373 5.0E-41
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2877 3373 5.0E-41
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2860 3375 5.0E-41
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2501 3444 9.0E-41
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1638 2356 1.0E-40
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1586 2311 1.0E-40
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2471 3451 1.0E-40
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2514 3464 3.0E-40
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1586 2311 4.0E-40
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1638 2323 5.0E-40
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 501 1171 7.0E-40
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1638 2295 8.0E-40
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1638 2311 9.0E-40
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1586 2311 2.0E-39
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2860 3373 3.0E-39
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1633 2328 4.0E-39
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2854 3373 4.0E-39
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1644 2329 5.0E-39
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1638 2295 8.0E-39
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2859 3284 8.0E-39
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1639 2324 2.0E-38
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2854 3375 2.0E-38
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1638 2147 3.0E-38
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2856 3374 5.0E-38
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2856 3374 6.0E-38
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1622 2329 8.0E-38
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2874 3372 1.0E-37
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2856 3374 1.0E-37
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2856 3374 1.0E-37
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1633 2324 2.0E-37
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1633 2323 2.0E-37
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1644 2329 2.0E-37
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1638 2323 2.0E-37
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2856 3374 2.0E-37
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2874 3375 2.0E-37
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2874 3375 4.0E-37
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2559 3372 6.0E-37
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2874 3372 7.0E-37
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2874 3375 9.0E-37
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2874 3375 9.0E-37
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2874 3372 9.0E-37
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2874 3375 1.0E-36
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2874 3375 1.0E-36
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2854 3374 1.0E-36
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2874 3375 1.0E-36
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1639 2314 2.0E-36
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2874 3372 2.0E-36
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2874 3372 3.0E-36
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2860 3542 4.0E-36
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2854 3374 8.0E-36
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2854 3373 1.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2873 3482 1.0E-35
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2501 3508 2.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2854 3373 3.0E-35
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2862 3446 4.0E-35
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2864 3446 2.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2874 3372 3.0E-34
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2864 3446 3.0E-34
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1633 2346 5.0E-34
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1633 2323 2.0E-33
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2860 3475 2.0E-33
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2834 3477 5.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2821 3450 5.0E-33
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2854 3451 6.0E-33
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1633 2331 1.0E-32
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2850 3449 1.0E-32
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2579 3450 1.0E-32
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2862 3451 1.0E-32
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2876 3372 1.0E-32
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2579 3450 2.0E-32
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1519 2318 4.0E-32
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2874 3475 4.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2874 3373 4.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2874 3373 6.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2874 3373 6.0E-32
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2862 3498 6.0E-32
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2406 3374 2.0E-31
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2784 3450 2.0E-31
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2888 3372 6.0E-31
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2913 3372 1.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2874 3373 1.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2874 3373 2.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2854 3374 2.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1902 2323 5.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2878 3450 5.0E-30
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1633 2323 2.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2852 3373 2.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2874 3373 2.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2874 3373 2.0E-29
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2863 3374 3.0E-29
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2579 3492 7.0E-29
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2799 3455 6.0E-28
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2798 3451 8.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2578 3439 1.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2785 3444 3.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2915 3375 7.0E-25
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2841 3470 9.0E-25
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2854 3372 2.0E-24
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1622 1938 3.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2239 3372 5.0E-24
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1638 1938 1.0E-23
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2906 3486 3.0E-23
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 541 1160 5.0E-23
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1608 1906 6.0E-23
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 14 434 7.0E-23
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1641 1938 7.0E-23
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2878 3457 8.0E-23
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2766 3474 1.0E-22
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1641 1885 1.0E-22
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 2860 3372 2.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 498 881 4.0E-22
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1614 1885 4.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2862 3444 6.0E-22
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1614 1885 6.0E-22
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1614 1885 9.0E-22
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1671 1885 1.0E-21
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1671 1885 1.0E-21
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1614 1885 2.0E-21
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 88 430 3.0E-21
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1614 1885 8.0E-21
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 3523 3832 8.0E-21
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 109 437 1.0E-20
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2855 3372 2.0E-20
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2872 3372 2.0E-20
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1632 1940 4.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2877 3373 6.0E-20
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 2865 3372 6.0E-20
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 91 437 7.0E-20
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2850 3372 8.0E-20
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 2866 3372 1.0E-19
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1631 1936 1.0E-19
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 2865 3372 1.0E-19
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1929 2166 2.0E-19
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 2865 3372 2.0E-19
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2850 3372 2.0E-19
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 88 439 2.0E-19
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 88 439 2.0E-19
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 88 439 2.0E-19
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 2877 3374 2.0E-19
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2878 3369 3.0E-19
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 88 439 3.0E-19
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 2865 3372 3.0E-19
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1671 1853 4.0E-19
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2876 3372 6.0E-19
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 88 439 7.0E-19
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 88 439 7.0E-19
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 160 439 7.0E-19
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1977 2321 8.0E-19
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1977 2321 8.0E-19
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2876 3377 8.0E-19
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1977 2321 9.0E-19
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2331 2828 1.0E-18
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 88 436 1.0E-18
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 88 435 1.0E-18
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2875 3379 1.0E-18
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2869 3372 2.0E-18
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2875 3379 2.0E-18
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2855 3377 3.0E-18
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 88 436 6.0E-18
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 78 435 6.0E-18
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 2873 3372 7.0E-18
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1643 1936 8.0E-18
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1960 2163 1.0E-17
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 162 434 1.0E-17
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 2865 3372 1.0E-17
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1632 1936 2.0E-17
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2878 3450 2.0E-17
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1613 1936 2.0E-17
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 24 430 2.0E-17
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1639 1929 2.0E-17
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2873 3372 2.0E-17
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 180 437 3.0E-17
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 180 437 3.0E-17
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 180 437 3.0E-17
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 88 436 5.0E-17
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 88 436 5.0E-17
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 2878 3372 6.0E-17
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 2873 3377 6.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 88 437 7.0E-17
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 2877 3372 7.0E-17
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 2877 3372 1.0E-16
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3002 3318 1.0E-16
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 2872 3372 1.0E-16
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1649 1941 2.0E-16
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 2865 3372 2.0E-16
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 2859 3372 2.0E-16
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 142 438 2.0E-16
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2854 3374 3.0E-16
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 2877 3372 3.0E-16
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 77 437 3.0E-16
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 2837 3372 3.0E-16
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 88 437 4.0E-16
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 2866 3372 4.0E-16
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2869 3372 4.0E-16
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 2870 3372 4.0E-16
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1963 2299 5.0E-16
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 164 436 6.0E-16
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 2870 3372 7.0E-16
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 88 437 8.0E-16
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 162 434 1.0E-15
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 2877 3372 1.0E-15
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 2873 3372 1.0E-15
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2875 3372 1.0E-15
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1934 2350 2.0E-15
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1934 2350 2.0E-15
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1934 2350 2.0E-15
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 2866 3372 2.0E-15
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2875 3372 2.0E-15
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 78 436 2.0E-15
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 2870 3372 2.0E-15
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2873 3372 2.0E-15
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 2912 3383 2.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1976 2140 3.0E-15
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 2877 3372 3.0E-15
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 2877 3372 4.0E-15
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 2877 3372 6.0E-15
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 14 437 6.0E-15
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 2994 3791 7.0E-15
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 2854 3372 7.0E-15
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 2865 3372 7.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1962 2374 8.0E-15
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 162 434 8.0E-15
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 2876 3372 9.0E-15
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 2870 3372 1.0E-14
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1633 1936 1.0E-14
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 2870 3372 1.0E-14
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 2873 3372 1.0E-14
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2844 3372 1.0E-14
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 2873 3372 1.0E-14
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 2873 3372 1.0E-14
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 2877 3372 1.0E-14
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 165 438 2.0E-14
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 2870 3372 2.0E-14
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 2877 3372 2.0E-14
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1671 1897 2.0E-14
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 180 437 2.0E-14
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 2870 3397 2.0E-14
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 2865 3372 2.0E-14
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 159 394 2.0E-14
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 2865 3372 2.0E-14
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 2873 3372 2.0E-14
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2834 3372 3.0E-14
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 2854 3372 3.0E-14
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2878 3374 3.0E-14
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 2852 3372 3.0E-14
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 2870 3372 4.0E-14
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 2877 3391 4.0E-14
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2844 3372 4.0E-14
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2844 3372 5.0E-14
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2875 3372 5.0E-14
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2877 3379 5.0E-14
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 109 437 5.0E-14
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2860 3374 5.0E-14
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2860 3374 5.0E-14
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1644 1941 7.0E-14
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 2854 3372 7.0E-14
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 2873 3409 8.0E-14
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2850 3378 1.0E-13
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2903 3375 1.0E-13
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2844 3372 1.0E-13
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 2870 3372 1.0E-13
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 2877 3372 1.0E-13
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 180 437 1.0E-13
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 180 437 1.0E-13
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 180 437 1.0E-13
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 180 437 1.0E-13
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 2849 3372 1.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2876 3374 1.0E-13
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 2877 3372 1.0E-13
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 2870 3372 2.0E-13
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 9 394 2.0E-13
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 2877 3372 2.0E-13
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 2 444 2.0E-13
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 14 394 2.0E-13
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2875 3372 2.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1977 2172 3.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1977 2172 3.0E-13
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1934 2129 3.0E-13
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 77 434 3.0E-13
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 2870 3372 3.0E-13
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 2871 3409 3.0E-13
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 2874 3372 3.0E-13
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 3416 3821 4.0E-13
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 2870 3372 4.0E-13
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 2876 3396 4.0E-13
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 2854 3372 4.0E-13
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 2854 3372 4.0E-13
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 2877 3372 4.0E-13
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 14 394 5.0E-13
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 180 437 5.0E-13
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2874 3372 5.0E-13
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2874 3372 5.0E-13
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 2877 3372 5.0E-13
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 540 844 5.0E-13
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 2870 3372 5.0E-13
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 543 838 5.0E-13
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 2870 3372 5.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 143 436 5.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 143 436 5.0E-13
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 37 140 6.0E-13
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 2870 3372 7.0E-13
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 2870 3372 7.0E-13
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2855 3378 8.0E-13
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 2877 3377 8.0E-13
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3002 3474 9.0E-13
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1632 1938 9.0E-13
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2844 3360 1.0E-12
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2980 3372 1.0E-12
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 2854 3372 1.0E-12
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 2872 3372 1.0E-12
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 2870 3372 1.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1960 2318 2.0E-12
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 2849 3372 2.0E-12
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2999 3375 2.0E-12
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 2870 3372 2.0E-12
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1648 1861 2.0E-12
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 2875 3372 2.0E-12
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2877 3372 2.0E-12
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 2870 3372 2.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2864 3372 2.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2838 3372 2.0E-12
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 2854 3372 3.0E-12
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 2877 3372 3.0E-12
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 2877 3372 3.0E-12
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 2870 3372 3.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2841 3377 3.0E-12
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1632 1851 3.0E-12
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 2877 3372 3.0E-12
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 2870 3372 3.0E-12
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 2877 3372 3.0E-12
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 540 845 3.0E-12
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 2870 3372 4.0E-12
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2856 3373 4.0E-12
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 14 437 4.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2674 3284 5.0E-12
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1632 1851 5.0E-12
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1689 1941 5.0E-12
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2869 3375 5.0E-12
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 2853 3378 5.0E-12
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 2870 3372 6.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2874 3372 6.0E-12
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 2870 3372 6.0E-12
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 2931 3374 6.0E-12
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 2874 3372 7.0E-12
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 2874 3372 7.0E-12
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 2875 3372 7.0E-12
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 2866 3372 7.0E-12
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 2870 3372 8.0E-12
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1618 1937 8.0E-12
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 2877 3372 8.0E-12
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 2877 3372 8.0E-12
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 2868 3372 9.0E-12
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 3416 3821 1.0E-11
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2878 3372 1.0E-11
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 2877 3372 1.0E-11
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 2854 3372 1.0E-11
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 2877 3372 1.0E-11
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 14 394 1.0E-11
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 2877 3372 1.0E-11
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 2877 3372 1.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1954 2346 2.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2374 2735 2.0E-11
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 159 394 2.0E-11
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 2931 3369 2.0E-11
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2998 3375 2.0E-11
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 2877 3372 2.0E-11
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 2870 3372 2.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 143 437 2.0E-11
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 540 746 2.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2999 3377 2.0E-11
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2877 3370 2.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 3523 3804 3.0E-11
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 2877 3372 3.0E-11
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 2994 3372 3.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1640 1871 3.0E-11
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 2877 3372 3.0E-11
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2997 3372 3.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1963 2283 4.0E-11
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 2896 3377 4.0E-11
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 2877 3372 4.0E-11
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 3517 3736 9.0E-11
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1930 2153 1.0E-10
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 3523 3787 1.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1953 2315 3.0E-09
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1941 2133 5.0E-09
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1941 2133 5.0E-09
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1941 2133 5.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1939 2169 2.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 906 1163 4.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1957 2348 5.0E-08
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2375 2741 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 27 PKS-NRPS hybrid

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5406
MSAEEACGTQDPTVIVGLACRVAGADTPSKLWENIAEQRDVQRKMPDKRFNVDAFFHPEPSHKGTTNARYGYFLD
QDVAKFDASFFGISGKEAEAMDPQQRLLLEVVYEALEDAGITLDEIRGSLTSVFCGSFTNDYNAMLTKDLESYPK
YTVTGTGNAILSNRISYFYDLHGTSVTIDTACSSSLVCFHLGSQTLQNGEADISLVVGSALHYDSNVFITMTDLG
MLSTNGRCAAFDASGSGYVRGEGIACAVLKRAADARAHGDVVRAVVRATGTNHDGGGGKKGITLPSGAAQERLIR
ETYARAGLDPADTQYFEAHGTGTAAGDPIEAAAVGAVFAAGRRGVLWMGSVKTNIGHLEGASGLAGIIKTTLALE
KGMIPPNMHFDTPNPKIDFAGCRLAVPTRVMAWEVAPGAVRRASINSFGYGGTNAHVVLEEYVAASQVAAEALEP
GHDDAQRPHLLPLTSHSPKAGELTEKALLEFLESASGVTLGSLAHSLSTRRTMHAQRSFIVSSSIASVAEQLCSA
RQHAPWTLAGKTPPRIGFVFTGQGAQWHGMARQLMSHCRLFTQTLERCDALLKTLPDGPEWSIVEELERPLDACR
LGETLYSQTICTALQVALVDLLACWGIRPAAVVGHSSGEVAAAYAAGILSLDGAVAAAYYRGLYMAASGEDSARG
GMMAVGLPEQKCRQELEAFAGRLVLAAVNSPFTMTVSGDEDALTELGDLLLAEKVFVRRLAVKQAFHSHHMVPLA
PAYQCALEQTAALKQGACVAQCRMFSSVTARLADPMGMGAAYWAANMVQPVRFSDALTGILLDERDEQNVDVLVE
IGPHPALRGPARQTAQALRLDLPYIGSLARGVADFESLLSMAGTLFCLGCAVDLAAVNAKLSRAADGSLVQTATG
SRLDKLPTYSWQHGRYWAETRVIREHRQRPFRHSLLGHGVAGSVARRPRFRNYLRLSELPWLSGHVVENKAVFPG
AGYISMAVEAAVRTDELDGVEMVQVKQVVIKKALLIPSTDEGVEVVVELEPVVLSARSQSDTWYKFEVFSYDDGS
NCTSHCHGLISVARGRAAPLDASCLTTDKSAASSLSFTELRKRTWRSVPAHSFYKSMAKLGLCYGDCFRLLRGSI
ESGEGFAMSELVFDPSVLPSEAGDETILHPTLLDAFFHVMFLAIQERLGRPLDEPYVPSYLASLKLSGRFFDLRH
DRGVKRFCVASFTKLPSPRVAMSSLFMRDETDDLVMDISGLELTSLGRHVVEGQAPRALFYRLRWQPCFDLLPDG
QEAALPELIDLYAHQYPNASMLYIAADLEHMDGLLRRLGVLQGERRRLKHMDVWCAGRSGDDLVAGAEELCKTSR
GLVTVVSAPERASYDVVIVNEAVSDAALFVKGSGHVVMSDLAVDSCTASGLVRVFRSKGYTAFRTLSDAYSAPTE
LSVIVPRATPSTRVASILEALHAAYPGRLLPITFDAIVSGSASPCSNVIVLAGLDESASEKTVFLGAQRLLTSVQ
KNIVWATEGATFATSRPESAIYLGLVRVASSENDALRALVFDFAAESPASSIAANLVRLLDTGIAEGEVAEQEGI
IYIPRVEADDERNCKLTNGPNQEPRLEPFGTPDTQTALALRIGKVGLLETLHFGQDEQVEDTELGDEDVEVETRA
SSINFRDVAASMGIIEDSELGDECAGLCTRVGSRVTGFKAGDRVVALRPGQGAHRSLVRNPASWCYKLPESMSFV
EAAAMPLILGTAWFALDHTARLARGETLLIHAAAGGVGQMAIQIAQGVGARILATVGSPAKRQLLKDTYGLADEQ
IFSSRNDLFVKGVMGATGGRGVDVVLNSLAGPLLHASWACLAPFGRFVEIGKRDIHENASISMDPFRRNVLFASI
DLVTMFEQNKPLGARLFKECFDLIASGKIKAPATIRQFSYAELVKGFRMLQMGRHTGKIVLVPHAEDMVPVLRSG
YRNTKLFSAEKTYLLVGGLGGLGRTLSQWMVRKGATKLAFLSRSGADKPEAKVTMQWLIERGISVGIYRGDVSQA
CHVAACVDSIGSSLGGLFQAAMVLHDKPLETMTHAQWQSCCLPKVEGTRNLHQATLGRKLDFFISFSSVACIVGS
KGQANYAAANCFLDALMRHRRQAGLVGTSINVGAVTGVGVVAENEELHKKLLRMGMDTINEQELLYQVEEAVLAN
GTLASLTPRGCTAHQIISGVGLVSPNIYWASKPMMKNLYVNHDFGGDGAADQTQKNLLAILKNEPEMDKRLALLL
DGFLDKIAEVLATPRESILASSPLSAYGLDSIVAVEFRKWFRNEVQVDIALFDILGAASINALVSKTVRMMAKSP
LAKETVVKSHAANDQTASRVEVEGPSDKTVNSAMASGELTKASAEGASPLSTFQSRLWFVHSFLDDKSLLNLPVV
LHMRGKPDHASLQTTLRELAWRNPVLRSAYFEGEECSMQQPMDDFELDLDYQDFSCISYASTEQQAKSSDQASKA
KQALLGELLQHKRLMEMNVDEGQVASFCLVKLSDLEWAMVAVAHHMSIDRGSLFPMMSQFVAIYDAVRAKTDLAF
VAAPEFDYVDFTLWHNARLASDLMKPDLEWWRRTLEGVAQSSKLLPFARFEQRPARGEPQREKVRTTIEANMFAR
MKRISAQSGATPFHFVLAAFRAFIYRYTEEKDVVLLMVDGNRPHPDTESLVGFFVNLAPVRCNDDCDVPFDQLFQ
ATKRRALDAMAHSGVPFDTIVDIVKAQKTSSHMPLGQIAVNYQIHGPAPAYQTVDFVVDDITSSDIPTAAEMQLE
AIETSQHCLDLKIEYATLLYSDADMERFVDNFGVFLTNCIRDHRQPVDEIAMCGPLEMDLLGSRYWNTQTRENQW
QRRSVLDVIASQQPLAVAINTSDGDAMSYQELMQNASSLAAALLDAGLVPGQCIGVVALPGVEAIVAVLGILMLG
ACYVALDVDFAEDRLAFMVKDSRAAALVVGKEHEGLAARLAAKSVGGAPVVLRVDEACARAGCLARQRPRQPQDP
FYMIYTSGSTGTPKGVVLSEANTQAMLASLNKHLDFGHTDVFLAHTTMAFDLSVVQIFGALTAGATVSLASWETR
KDPAALARFMEQQGVSVTYFTPTQYSLLVEANSGALRRCSKYRVALFAGERLPVRLVRAFFHLGLGASLYNTWAP
SELVVQTTLAKIDAPPQGVVSLPIGYPLDNCRHYIVDARGEPVPCGHVGELVVGGAQVGVGYLHRPELNAQFFVR
NVFASDDDCRRGWTRMFKTGDRGRFRPDGQLEFHGRIAGDKQIKLRGFRLDLGEVEHVLFRESQLLYTGALADIA
VVARTVESGDTQLVAFILLRDKMVQGAAKAAVVSRLHQSVKPHLNHYMLPSGYQFIDQLPLTIGGKVNRRELLER
RLDLVYPSSVTTRLKESHAADLSEACAPAVDHLDKSVIALFQTVLGGVQVRLHDSFFDRGGNSILLIRLHAKIKR
KFKLAPPLPALIRQPTAAAVCAYIRSGGGTADVQSNRAMINWKTETNLPNMSQYMPHFDALSLVQNFAEFGAVLL
TGAETFIGVHVLAALLRNKADVTVHVVGSMQRLEFAPLLHLLAKHQLLDQDGLDADQVTRRVCLVPGALSEPNLG
LSRSAFGSLGAAVDAIYHLGGHVSLLKPYSALRRLNVAPVLDMIRLAGCGRRVSALHYLSTWSVAHLQTWTGATR
TRDDYVTAEEPCTHFTPPTDDAAGYFKTRWVAESLLVEAARRGFPVTIVRASAVTAARADGGAAGDVLDPADELT
MRMVVDMVDSGTVPSIGRDDQPGFAIDVVPVDWLAESLVALTTRSRHKAACPSTAAAASSSPTPSLHIFHLSNPQ
PLALRRLPLIIAQLRPGHGQLISLSEWLATMAAQGQDDASQRARNEAVRQTLETGSVMFSLQNTWTMGVLEEQRP
GLVAKCPAVDAVFLKALWERMGRG*
Coding >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGACAAATGCGCGATATGGATACTTTTTAGAC
CAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGCCGAGGCTATGGATCCGCAGCAG
CGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCTGGATGAGATTCGGGGGTCTCTA
ACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAAGGATCTCGAGTCATATCCCAAG
TACACGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCATACTTTTACGACCTCCACGGCACAAGC
GTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTGGCAGCCAGACACTGCAGAATGGCGAG
GCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACGTCTTCATCACCATGACGGACCTGGGG
ATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCGGCTACGTACGCGGCGAGGGGATTGCC
TGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGGTGCGGGCCGTGGTGCGGGCCACGGGC
ACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCGGCGCGGCGCAGGAGCGGCTGATTCGC
GAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTGAGGCGCATGGCACGGGCACGGCGGCG
GGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGAGGAGAGGAGTGCTGTGGATGGGGTCG
GTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCATCATCAAGACGACGCTGGCGTTGGAA
AAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGATTGATTTTGCTGGTTGCAGGCTGGCG
GTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGCGGGCGAGTATTAATTCGTTTGGCTAT
GGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCCAAGTGGCGGCAGAGGCTCTGGAGCCG
GGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACTCGCCCAAGGCGGGTGAGCTAACGGAA
AAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCAGCCTGGCGCACAGTCTGTCGACGCGG
CGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAAGTGTTGCCGAGCAGCTCTGCTCAGCC
AGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTGGCTTCGTCTTTACCGGGCAGGGCGCG
CAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTACGCAGACACTGGAGCGATGCGACGCG
CTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGCTGGAGAGGCCGCTCGACGCGTGCCGG
CTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGGCGCTTGTGGACTTGCTTGCGTGCTGG
GGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGGCGGCGTATGCAGCTGGGATACTCAGC
CTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGGCCTCGGGAGAGGATTCGGCCAGGGGA
GGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGGAGGCGTTTGCTGGGCGGCTGGTGCTG
GCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACGCCCTGACGGAGCTGGGAGATTTGTTG
CTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTCACTCGCACCACATGGTTCCGCTGGCG
CCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAGCGTGTGTGGCGCAGTGTCGCATGTTT
TCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGTACTGGGCTGCCAACATGGTGCAGCCG
GTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACGAGCAAAATGTGGATGTCTTGGTTGAG
ATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGGCGCTGAGGCTTGACTTGCCGTATATT
GGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGGCTGGCACGCTCTTTTGTCTCGGCTGC
GCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACGGATCCCTCGTGCAGACGGCAACGGGC
TCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACTGGGCCGAGACGCGAGTTATTCGGGAG
CACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGGGCTCGGTGGCGCGGCGGCCGCGTTTT
CGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGGTTGAAAACAAGGCGGTGTTTCCGGGC
GCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGCTGGACGGGGTGGAAATGGTGCAGGTC
AAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGGGCGTCGAGGTTGTTGTCGAGCTGGAG
CCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTGAAGTCTTTTCGTACGATGATGGTTCA
AATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAGCTGCGCCGCTTGACGCTTCTTGCTTG
ACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGAAAAGAACGTGGCGGTCGGTGCCGGCT
CACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACTGCTTCCGTCTCCTAAGGGGAAGCATA
GAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCGTCTTGCCGAGCGAGGCGGGCGATGAA
ACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTCTCGCTATACAGGAGCGGCTGGGACGC
CCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCTCGGGCAGGTTTTTTGATTTGAGGCAC
GACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCTCGCCGCGCGTTGCCATGAGCAGCCTG
TTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGGAGCTCACCTCGCTGGGCCGCCATGTT
GTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGCCGTGCTTTGACTTGTTGCCAGACGGA
CAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATCCCAATGCGTCCATGTTGTATATTGCA
GCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGCAGGGCGAGCGGCGTCGTTTGAAGCAC
ATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGGCGGAGGAGCTGTGCAAGACGTCAAGA
GGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCGTTATTGTTAACGAGGCGGTGTCGGAT
GCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGGCCGTCGATTCTTGCACTGCGTCGGGT
CTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGTCTGATGCCTATAGTGCGCCTACAGAG
CTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGATTCTGGAAGCGCTGCACGCTGCATAC
CCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCGCCAGCCCGTGCAGCAACGTCATTGTC
CTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCGCCCAGCGCCTGCTCACGTCGGTGCAA
AAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGCCCGAGAGCGCCATCTATCTCGGACTG
GTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTGACTTTGCCGCCGAGTCGCCAGCCTCG
TCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGGGAGAGGTGGCGGAGCAAGAGGGCATC
ATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGACAAACGGACCGAACCAAGAGCCGCGG
CTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCATTGGCAAGGTTGGACTGTTGGAAACG
CTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACGAGGATGTCGAGGTGGAAACACGGGCT
TCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGGACTCGGAGCTTGGCGACGAATGCGCG
GGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGGACCGCGTCGTTGCTCTGCGGCCGGGC
CAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACAAGCTGCCAGAGAGCATGTCTTTTGTT
GAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTGACCACACTGCTCGGTTGGCCAGAGGG
GAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCATTCAGATTGCCCAGGGCGTGGGTGCG
CGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGGACACGTATGGGCTGGCCGATGAGCAG
ATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGACGGGCGGGCGCGGTGTGGATGTGGTG
CTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGGCGCCCTTTGGCCGCTTTGTCGAGATT
GGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTAGACGCAACGTGCTCTTTGCCTCGATT
GACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCTTCAAGGAGTGTTTTGACCTTATTGCC
AGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCGAGCTTGTAAAGGGCTTTCGAATGCTG
CAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGGACATGGTGCCCGTGCTGCGCAGCGGC
TACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTGGTGGGCTTGGCGGGCTGGGACGGACT
CTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGTCTCGCTCTGGCGCTGACAAGCCCGAG
GCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCATCTACCGCGGAGACGTTTCCCAAGCA
TGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCCTTTTCCAAGCCGCCATGGTGCTGCAC
GACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTCTGCCCAAGGTTGAGGGCACGCGCAAC
CTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCTCCTCTGTAGCCTGCATCGTCGGGTCC
AAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGATGCGCCATCGCAGGCAAGCAGGGCTG
GTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTGCCGAGAACGAGGAGCTGCATAAGAAG
CTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACCAGGTGGAGGAGGCAGTCTTGGCTAAT
GGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTATTAGCGGCGTGGGCCTCGTCTCTCCA
AATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACCACGACTTTGGCGGGGATGGGGCCGCC
GACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAATGGACAAGAGGCTGGCGCTGCTGCTG
GACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGTCCATCTTGGCCAGCAGTCCGTTATCG
GCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCCGCAACGAGGTGCAGGTTGACATTGCC
CTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAACGGTACGAATGATGGCCAAGAGCCCA
TTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGGCGAGCCGGGTGGAGGTGGAGGGCCCC
AGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGGCGAGTGCGGAGGGCGCCAGTCCCCTG
TCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACAAGTCGCTGCTTAACCTGCCCGTGGTG
CTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGCGGGAGCTGGCGTGGCGGAATCCGGTG
CTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCATGGACGACTTTGAGCTCGACCTCGAC
TACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCAAGTCGAGCGACCAGGCAAGCAAGGCA
AAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGATGAATGTCGACGAGGGCCAAGTAGCC
AGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGGTGGCACACCACATGTCGATTGACCGG
GGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGGTGCGGGCCAAGACGGACCTGGCCTTT
GTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATGCGCGGCTGGCGTCGGACCTGATGAAG
CCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTAGCAAGCTGTTGCCCTTTGCGCGCTTT
GAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGACAATCGAGGCCAACATGTTTGCTCGC
ATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCCTGGCGGCCTTTCGCGCCTTTATCTAT
CGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACCGGCCGCATCCAGACACTGAGTCGCTA
GTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGACGACTGCGACGTGCCATTTGACCAGTTATTCCAA
GCCACCAAGCGGCGCGCTCTCGACGCCATGGCCCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAG
GCGCAAAAGACGAGCAGCCACATGCCGCTCGGCCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCC
TACCAGACAGTCGACTTTGTCGTTGACGACATTACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAG
GCCATTGAGACGTCGCAGCACTGTCTAGACCTCAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATG
GAGCGCTTCGTGGACAACTTTGGCGTCTTTTTGACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATT
GCCATGTGTGGGCCGCTAGAGATGGACTTGTTGGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGG
CAGCGGCGCAGCGTGCTCGACGTGATTGCCAGCCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGAC
GCCATGTCGTACCAAGAACTCATGCAAAATGCATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCG
GGGCAGTGCATCGGAGTAGTAGCTCTGCCGGGCGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGC
GCGTGCTACGTTGCGCTTGATGTCGACTTTGCAGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCG
GCTCTAGTCGTGGGCAAGGAGCATGAGGGGCTGGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTC
GTGCTGAGGGTTGATGAGGCGTGTGCTCGAGCCGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCC
TTTTACATGATTTACACATCGGGAAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCC
ATGCTTGCTTCGCTCAACAAGCATCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTT
GACCTTTCCGTCGTGCAAATCTTTGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGC
AAGGACCCTGCTGCTCTGGCCCGCTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTAC
TCTCTCCTCGTCGAAGCCAACTCTGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAG
CGGCTTCCCGTTCGTCTGGTTAGGGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCC
TCTGAACTCGTGGTGCAGACGACGCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGC
TATCCCTTGGATAACTGCCGTCACTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAG
CTGGTTGTTGGCGGAGCTCAAGTCGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGC
AATGTCTTTGCCTCGGACGACGATTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTT
CGTCCCGACGGACAGCTCGAGTTTCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTT
GATTTGGGCGAGGTGGAGCACGTCTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCC
GTTGTGGCGCGCACTGTCGAGTCTGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAA
GGCGCGGCCAAGGCGGCTGTCGTTTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCC
AGCGGCTATCAGTTTATTGACCAGTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGT
CGGCTGGACCTGGTTTACCCTTCATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCT
TGTGCGCCAGCCGTCGATCATCTCGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTG
CGCCTGCACGACTCCTTCTTTGACCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGC
AAATTCAAGCTTGCTCCCCCGCTGCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGC
AGCGGAGGCGGCACAGCAGATGTGCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAAC
ATGAGCCAGTACATGCCGCACTTTGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTG
ACGGGAGCAGAGACATTTATAGGTGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCAT
GTCGTGGGCTCCATGCAAAGACTCGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAA
GACGGTCTCGACGCAGACCAGGTAACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGC
CTCTCACGGTCCGCCTTTGGCAGCCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTC
CTAAAGCCCTACTCGGCGCTGCGGCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGG
CGACGCGTCTCAGCGCTGCACTACCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGA
ACGCGTGACGACTATGTGACAGCCGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTAC
TTCAAGACGCGGTGGGTGGCTGAGAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGC
GCGTCGGCAGTGACTGCGGCCCGGGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACG
ATGCGCATGGTGGTGGACATGGTTGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCC
ATTGATGTGGTTCCTGTCGACTGGCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCT
TGTCCCTCTACCGCTGCTGCGGCATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAG
CCCCTTGCGCTACGACGTCTTCCTCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGC
GAGTGGCTTGCAACCATGGCAGCCCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAG
ACGCTCGAGACGGGTTCCGTCATGTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCG
GGGCTGGTGGCAAAGTGTCCTGCAGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG
Transcript >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGACAAATGCGCGATATGGATACTTTTTAGAC
CAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGCCGAGGCTATGGATCCGCAGCAG
CGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCTGGATGAGATTCGGGGGTCTCTA
ACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAAGGATCTCGAGTCATATCCCAAG
TACACGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCATACTTTTACGACCTCCACGGCACAAGC
GTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTGGCAGCCAGACACTGCAGAATGGCGAG
GCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACGTCTTCATCACCATGACGGACCTGGGG
ATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCGGCTACGTACGCGGCGAGGGGATTGCC
TGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGGTGCGGGCCGTGGTGCGGGCCACGGGC
ACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCGGCGCGGCGCAGGAGCGGCTGATTCGC
GAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTGAGGCGCATGGCACGGGCACGGCGGCG
GGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGAGGAGAGGAGTGCTGTGGATGGGGTCG
GTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCATCATCAAGACGACGCTGGCGTTGGAA
AAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGATTGATTTTGCTGGTTGCAGGCTGGCG
GTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGCGGGCGAGTATTAATTCGTTTGGCTAT
GGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCCAAGTGGCGGCAGAGGCTCTGGAGCCG
GGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACTCGCCCAAGGCGGGTGAGCTAACGGAA
AAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCAGCCTGGCGCACAGTCTGTCGACGCGG
CGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAAGTGTTGCCGAGCAGCTCTGCTCAGCC
AGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTGGCTTCGTCTTTACCGGGCAGGGCGCG
CAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTACGCAGACACTGGAGCGATGCGACGCG
CTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGCTGGAGAGGCCGCTCGACGCGTGCCGG
CTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGGCGCTTGTGGACTTGCTTGCGTGCTGG
GGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGGCGGCGTATGCAGCTGGGATACTCAGC
CTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGGCCTCGGGAGAGGATTCGGCCAGGGGA
GGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGGAGGCGTTTGCTGGGCGGCTGGTGCTG
GCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACGCCCTGACGGAGCTGGGAGATTTGTTG
CTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTCACTCGCACCACATGGTTCCGCTGGCG
CCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAGCGTGTGTGGCGCAGTGTCGCATGTTT
TCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGTACTGGGCTGCCAACATGGTGCAGCCG
GTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACGAGCAAAATGTGGATGTCTTGGTTGAG
ATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGGCGCTGAGGCTTGACTTGCCGTATATT
GGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGGCTGGCACGCTCTTTTGTCTCGGCTGC
GCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACGGATCCCTCGTGCAGACGGCAACGGGC
TCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACTGGGCCGAGACGCGAGTTATTCGGGAG
CACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGGGCTCGGTGGCGCGGCGGCCGCGTTTT
CGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGGTTGAAAACAAGGCGGTGTTTCCGGGC
GCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGCTGGACGGGGTGGAAATGGTGCAGGTC
AAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGGGCGTCGAGGTTGTTGTCGAGCTGGAG
CCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTGAAGTCTTTTCGTACGATGATGGTTCA
AATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAGCTGCGCCGCTTGACGCTTCTTGCTTG
ACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGAAAAGAACGTGGCGGTCGGTGCCGGCT
CACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACTGCTTCCGTCTCCTAAGGGGAAGCATA
GAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCGTCTTGCCGAGCGAGGCGGGCGATGAA
ACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTCTCGCTATACAGGAGCGGCTGGGACGC
CCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCTCGGGCAGGTTTTTTGATTTGAGGCAC
GACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCTCGCCGCGCGTTGCCATGAGCAGCCTG
TTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGGAGCTCACCTCGCTGGGCCGCCATGTT
GTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGCCGTGCTTTGACTTGTTGCCAGACGGA
CAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATCCCAATGCGTCCATGTTGTATATTGCA
GCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGCAGGGCGAGCGGCGTCGTTTGAAGCAC
ATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGGCGGAGGAGCTGTGCAAGACGTCAAGA
GGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCGTTATTGTTAACGAGGCGGTGTCGGAT
GCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGGCCGTCGATTCTTGCACTGCGTCGGGT
CTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGTCTGATGCCTATAGTGCGCCTACAGAG
CTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGATTCTGGAAGCGCTGCACGCTGCATAC
CCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCGCCAGCCCGTGCAGCAACGTCATTGTC
CTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCGCCCAGCGCCTGCTCACGTCGGTGCAA
AAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGCCCGAGAGCGCCATCTATCTCGGACTG
GTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTGACTTTGCCGCCGAGTCGCCAGCCTCG
TCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGGGAGAGGTGGCGGAGCAAGAGGGCATC
ATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGACAAACGGACCGAACCAAGAGCCGCGG
CTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCATTGGCAAGGTTGGACTGTTGGAAACG
CTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACGAGGATGTCGAGGTGGAAACACGGGCT
TCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGGACTCGGAGCTTGGCGACGAATGCGCG
GGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGGACCGCGTCGTTGCTCTGCGGCCGGGC
CAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACAAGCTGCCAGAGAGCATGTCTTTTGTT
GAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTGACCACACTGCTCGGTTGGCCAGAGGG
GAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCATTCAGATTGCCCAGGGCGTGGGTGCG
CGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGGACACGTATGGGCTGGCCGATGAGCAG
ATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGACGGGCGGGCGCGGTGTGGATGTGGTG
CTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGGCGCCCTTTGGCCGCTTTGTCGAGATT
GGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTAGACGCAACGTGCTCTTTGCCTCGATT
GACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCTTCAAGGAGTGTTTTGACCTTATTGCC
AGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCGAGCTTGTAAAGGGCTTTCGAATGCTG
CAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGGACATGGTGCCCGTGCTGCGCAGCGGC
TACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTGGTGGGCTTGGCGGGCTGGGACGGACT
CTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGTCTCGCTCTGGCGCTGACAAGCCCGAG
GCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCATCTACCGCGGAGACGTTTCCCAAGCA
TGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCCTTTTCCAAGCCGCCATGGTGCTGCAC
GACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTCTGCCCAAGGTTGAGGGCACGCGCAAC
CTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCTCCTCTGTAGCCTGCATCGTCGGGTCC
AAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGATGCGCCATCGCAGGCAAGCAGGGCTG
GTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTGCCGAGAACGAGGAGCTGCATAAGAAG
CTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACCAGGTGGAGGAGGCAGTCTTGGCTAAT
GGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTATTAGCGGCGTGGGCCTCGTCTCTCCA
AATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACCACGACTTTGGCGGGGATGGGGCCGCC
GACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAATGGACAAGAGGCTGGCGCTGCTGCTG
GACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGTCCATCTTGGCCAGCAGTCCGTTATCG
GCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCCGCAACGAGGTGCAGGTTGACATTGCC
CTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAACGGTACGAATGATGGCCAAGAGCCCA
TTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGGCGAGCCGGGTGGAGGTGGAGGGCCCC
AGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGGCGAGTGCGGAGGGCGCCAGTCCCCTG
TCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACAAGTCGCTGCTTAACCTGCCCGTGGTG
CTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGCGGGAGCTGGCGTGGCGGAATCCGGTG
CTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCATGGACGACTTTGAGCTCGACCTCGAC
TACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCAAGTCGAGCGACCAGGCAAGCAAGGCA
AAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGATGAATGTCGACGAGGGCCAAGTAGCC
AGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGGTGGCACACCACATGTCGATTGACCGG
GGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGGTGCGGGCCAAGACGGACCTGGCCTTT
GTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATGCGCGGCTGGCGTCGGACCTGATGAAG
CCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTAGCAAGCTGTTGCCCTTTGCGCGCTTT
GAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGACAATCGAGGCCAACATGTTTGCTCGC
ATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCCTGGCGGCCTTTCGCGCCTTTATCTAT
CGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACCGGCCGCATCCAGACACTGAGTCGCTA
GTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGACGACTGCGACGTGCCATTTGACCAGTTATTCCAA
GCCACCAAGCGGCGCGCTCTCGACGCCATGGCCCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAG
GCGCAAAAGACGAGCAGCCACATGCCGCTCGGCCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCC
TACCAGACAGTCGACTTTGTCGTTGACGACATTACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAG
GCCATTGAGACGTCGCAGCACTGTCTAGACCTCAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATG
GAGCGCTTCGTGGACAACTTTGGCGTCTTTTTGACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATT
GCCATGTGTGGGCCGCTAGAGATGGACTTGTTGGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGG
CAGCGGCGCAGCGTGCTCGACGTGATTGCCAGCCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGAC
GCCATGTCGTACCAAGAACTCATGCAAAATGCATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCG
GGGCAGTGCATCGGAGTAGTAGCTCTGCCGGGCGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGC
GCGTGCTACGTTGCGCTTGATGTCGACTTTGCAGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCG
GCTCTAGTCGTGGGCAAGGAGCATGAGGGGCTGGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTC
GTGCTGAGGGTTGATGAGGCGTGTGCTCGAGCCGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCC
TTTTACATGATTTACACATCGGGAAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCC
ATGCTTGCTTCGCTCAACAAGCATCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTT
GACCTTTCCGTCGTGCAAATCTTTGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGC
AAGGACCCTGCTGCTCTGGCCCGCTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTAC
TCTCTCCTCGTCGAAGCCAACTCTGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAG
CGGCTTCCCGTTCGTCTGGTTAGGGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCC
TCTGAACTCGTGGTGCAGACGACGCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGC
TATCCCTTGGATAACTGCCGTCACTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAG
CTGGTTGTTGGCGGAGCTCAAGTCGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGC
AATGTCTTTGCCTCGGACGACGATTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTT
CGTCCCGACGGACAGCTCGAGTTTCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTT
GATTTGGGCGAGGTGGAGCACGTCTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCC
GTTGTGGCGCGCACTGTCGAGTCTGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAA
GGCGCGGCCAAGGCGGCTGTCGTTTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCC
AGCGGCTATCAGTTTATTGACCAGTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGT
CGGCTGGACCTGGTTTACCCTTCATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCT
TGTGCGCCAGCCGTCGATCATCTCGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTG
CGCCTGCACGACTCCTTCTTTGACCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGC
AAATTCAAGCTTGCTCCCCCGCTGCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGC
AGCGGAGGCGGCACAGCAGATGTGCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAAC
ATGAGCCAGTACATGCCGCACTTTGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTG
ACGGGAGCAGAGACATTTATAGGTGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCAT
GTCGTGGGCTCCATGCAAAGACTCGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAA
GACGGTCTCGACGCAGACCAGGTAACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGC
CTCTCACGGTCCGCCTTTGGCAGCCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTC
CTAAAGCCCTACTCGGCGCTGCGGCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGG
CGACGCGTCTCAGCGCTGCACTACCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGA
ACGCGTGACGACTATGTGACAGCCGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTAC
TTCAAGACGCGGTGGGTGGCTGAGAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGC
GCGTCGGCAGTGACTGCGGCCCGGGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACG
ATGCGCATGGTGGTGGACATGGTTGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCC
ATTGATGTGGTTCCTGTCGACTGGCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCT
TGTCCCTCTACCGCTGCTGCGGCATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAG
CCCCTTGCGCTACGACGTCTTCCTCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGC
GAGTGGCTTGCAACCATGGCAGCCCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAG
ACGCTCGAGACGGGTTCCGTCATGTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCG
GGGCTGGTGGCAAAGTGTCCTGCAGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG
Gene >OphauB2|5406
ATGAGTGCCGAGGAGGCATGCGGGACGCAGGACCCGACAGTCATTGTCGGATTGGCGTGCCGCGTTGCGGGAGCA
GACACGCCGAGTAAACTGTGGGAGAATATTGCCGAGCAAAGAGATGTCCAACGCAAGATGCCGGACAAGAGGTTC
AACGTTGATGCCTTTTTCCACCCAGAGCCGAGCCACAAGGGGACGGTGAGTTGGTTATATATCTCTGCCCATTTT
ACGCATCTTGCCTTGCTTTTTTCAAAAAAGGGGTGGTTTTTGTTTTTTGGCTAACGTGGAGGTGTAGACAAATGC
GCGATATGGATACTTTTTAGACCAAGACGTTGCAAAGTTTGACGCGAGCTTCTTTGGCATTTCGGGCAAAGAGGC
CGAGGCTATGGATCCGCAGCAGCGGCTGCTGCTAGAAGTGGTGTATGAAGCGTTGGAGGATGCGGGCATTACGCT
GGATGAGATTCGGGGGTCTCTAACATCGGTGTTTTGCGGAAGCTTTACCAATGATTACAATGCCATGTTGACCAA
GGATCTCGAGTCATATCCCAAGTACACGGTGAGTTGGGCATGATGCTGGGAGGGAATCAGAGCTTGCTTTCTAAC
GCGTTGTTTATTCTTGGGTTGGGGGTGAGCAGGTTACGGGTACTGGAAATGCCATCTTGTCCAACAGAATATCAT
ACTTTTACGACCTCCACGGCACAAGCGTCACGATTGACACGGCGTGTTCGTCGTCTCTGGTTTGCTTCCACCTTG
GCAGCCAGACACTGCAGAATGGCGAGGCCGACATTTCCCTCGTGGTGGGCTCAGCGCTCCACTACGACAGCAACG
TCTTCATCACCATGACGGACCTGGGGATGCTCTCGACCAATGGGCGGTGCGCCGCCTTTGACGCGTCGGGCAGCG
GCTACGTACGCGGCGAGGGGATTGCCTGCGCGGTGCTGAAGCGCGCGGCCGACGCGCGAGCCCACGGCGACGTGG
TGCGGGCCGTGGTGCGGGCCACGGGCACAAACCACGACGGCGGGGGCGGCAAGAAGGGAATCACGCTGCCGAGCG
GCGCGGCGCAGGAGCGGCTGATTCGCGAGACGTATGCGAGGGCGGGGCTGGATCCGGCGGATACGCAGTACTTTG
AGGCGCATGGCACGGGCACGGCGGCGGGAGATCCAATAGAGGCGGCGGCGGTGGGAGCTGTGTTTGCGGCGGGGA
GGAGAGGAGTGCTGTGGATGGGGTCGGTAAAGACGAATATTGGACATCTTGAAGGCGCGTCGGGCTTGGCGGGCA
TCATCAAGACGACGCTGGCGTTGGAAAAGGGCATGATTCCGCCGAATATGCATTTTGACACGCCAAACCCCAAGA
TTGATTTTGCTGGTTGCAGGCTGGCGGTGCCGACGCGCGTCATGGCGTGGGAAGTTGCTCCAGGGGCGGTGCGGC
GGGCGAGTATTAATTCGTTTGGCTATGGCGGCACCAATGCTCATGTTGTGCTTGAGGAGTATGTCGCGGCAAGCC
AAGTGGCGGCAGAGGCTCTGGAGCCGGGCCATGACGATGCTCAGCGGCCACACCTCTTGCCGCTAACATCGCACT
CGCCCAAGGCGGGTGAGCTAACGGAAAAAGCACTCTTGGAATTCCTCGAGAGCGCAAGCGGCGTGACGCTGGGCA
GCCTGGCGCACAGTCTGTCGACGCGGCGCACCATGCACGCGCAGCGCTCCTTTATAGTCTCGAGCAGCATTGCAA
GTGTTGCCGAGCAGCTCTGCTCAGCCAGACAGCACGCTCCCTGGACGCTGGCCGGCAAGACGCCGCCGCGCATTG
GCTTCGTCTTTACCGGGCAGGGCGCGCAGTGGCACGGCATGGCGCGGCAGCTCATGTCGCACTGCCGCCTCTTTA
CGCAGACACTGGAGCGATGCGACGCGCTTCTCAAGACGCTGCCCGACGGGCCCGAGTGGTCCATTGTGGAGGAGC
TGGAGAGGCCGCTCGACGCGTGCCGGCTGGGCGAGACGCTCTACTCGCAAACGATTTGCACGGCGCTGCAGGTGG
CGCTTGTGGACTTGCTTGCGTGCTGGGGCATCAGGCCGGCTGCCGTGGTGGGCCATTCGTCGGGCGAGGTGGCGG
CGGCGTATGCAGCTGGGATACTCAGCCTCGACGGCGCCGTGGCGGCTGCCTATTACCGCGGCCTGTACATGGCGG
CCTCGGGAGAGGATTCGGCCAGGGGAGGCATGATGGCGGTGGGCCTGCCGGAGCAAAAGTGCAGGCAGGAGCTGG
AGGCGTTTGCTGGGCGGCTGGTGCTGGCGGCTGTCAATAGCCCCTTTACCATGACGGTGTCGGGCGACGAGGACG
CCCTGACGGAGCTGGGAGATTTGTTGCTTGCGGAAAAGGTCTTTGTGCGACGCCTGGCGGTCAAGCAGGCCTTTC
ACTCGCACCACATGGTTCCGCTGGCGCCGGCATACCAATGCGCACTCGAGCAGACGGCGGCCTTGAAGCAAGGAG
CGTGTGTGGCGCAGTGTCGCATGTTTTCGAGCGTGACGGCGCGTTTGGCGGATCCGATGGGCATGGGCGCGGCGT
ACTGGGCTGCCAACATGGTGCAGCCGGTTCGCTTCTCAGACGCCCTGACTGGCATCCTCTTGGACGAGCGCGACG
AGCAAAATGTGGATGTCTTGGTTGAGATTGGGCCGCATCCGGCGCTGCGGGGGCCGGCGAGGCAGACGGCACAGG
CGCTGAGGCTTGACTTGCCGTATATTGGCTCCCTGGCACGGGGCGTGGCCGACTTTGAAAGTCTGCTGTCCATGG
CTGGCACGCTCTTTTGTCTCGGCTGCGCAGTCGACTTGGCCGCTGTGAATGCAAAGCTGAGCCGCGCTGCCGACG
GATCCCTCGTGCAGACGGCAACGGGCTCGCGTCTGGACAAGCTCCCCACCTACTCGTGGCAGCACGGGCGGTACT
GGGCCGAGACGCGAGTTATTCGGGAGCACCGCCAGCGGCCCTTTAGGCACTCGCTCCTGGGCCACGGCGTGGCGG
GCTCGGTGGCGCGGCGGCCGCGTTTTCGCAACTACTTGCGTCTGAGCGAGCTGCCGTGGCTGAGCGGGCACGTGG
TTGAAAACAAGGCGGTGTTTCCGGGCGCGGGATACATTAGCATGGCTGTCGAGGCTGCGGTTCGCACAGACGAGC
TGGACGGGGTGGAAATGGTGCAGGTCAAGCAAGTGGTTATAAAAAAGGCGCTGCTGATTCCCAGTACGGACGAGG
GCGTCGAGGTTGTTGTCGAGCTGGAGCCGGTGGTGCTCTCGGCAAGGAGCCAGTCGGACACGTGGTACAAGTTTG
AAGTCTTTTCGTACGATGATGGTTCAAATTGCACAAGTCACTGCCACGGGCTCATTAGTGTGGCAAGAGGAAGAG
CTGCGCCGCTTGACGCTTCTTGCTTGACTACTGACAAGTCTGCTGCCAGCTCACTCTCTTTTACCGAGCTGCGGA
AAAGAACGTGGCGGTCGGTGCCGGCTCACTCGTTTTACAAGAGCATGGCCAAGCTGGGGCTCTGCTACGGCGACT
GCTTCCGTCTCCTAAGGGGAAGCATAGAGAGCGGCGAGGGCTTTGCCATGTCGGAGCTGGTCTTTGACCCGTCCG
TCTTGCCGAGCGAGGCGGGCGATGAAACCATTTTGCATCCGACTCTGCTCGATGCCTTTTTCCACGTCATGTTTC
TCGCTATACAGGAGCGGCTGGGACGCCCTCTTGACGAGCCCTATGTGCCATCCTATCTCGCCTCGCTCAAGCTCT
CGGGCAGGTTTTTTGATTTGAGGCACGACAGGGGCGTCAAGAGATTTTGCGTCGCGTCCTTTACTAAGCTGCCCT
CGCCGCGCGTTGCCATGAGCAGCCTGTTTATGCGAGATGAGACGGATGACCTCGTCATGGATATTTCGGGGCTGG
AGCTCACCTCGCTGGGCCGCCATGTTGTCGAGGGACAGGCGCCGCGGGCGCTCTTTTACCGTTTGCGCTGGCAGC
CGTGCTTTGACTTGTTGCCAGACGGACAAGAGGCGGCGTTGCCAGAGTTGATCGACTTGTACGCGCACCAGTATC
CCAATGCGTCCATGTTGTATATTGCAGCAGATTTGGAGCACATGGACGGCTTGTTGCGCCGGCTTGGAGTCTTGC
AGGGCGAGCGGCGTCGTTTGAAGCACATGGACGTTTGGTGTGCGGGTCGGAGTGGCGACGACTTGGTGGCGGGGG
CGGAGGAGCTGTGCAAGACGTCAAGAGGACTCGTCACGGTTGTTTCTGCGCCTGAGCGTGCTTCATACGACGTCG
TTATTGTTAACGAGGCGGTGTCGGATGCTGCGCTTTTTGTAAAAGGCAGTGGCCATGTTGTGATGAGCGACTTGG
CCGTCGATTCTTGCACTGCGTCGGGTCTGGTGCGGGTGTTTAGGAGCAAAGGATATACTGCTTTCCGCACCTTGT
CTGATGCCTATAGTGCGCCTACAGAGCTATCCGTCATTGTGCCTCGAGCAACGCCTTCGACGCGCGTTGCCTCGA
TTCTGGAAGCGCTGCACGCTGCATACCCGGGCCGTCTGCTGCCCATCACCTTTGACGCGATTGTCAGTGGCAGCG
CCAGCCCGTGCAGCAACGTCATTGTCCTTGCCGGGCTGGACGAGTCCGCGTCTGAAAAGACGGTCTTTCTGGGCG
CCCAGCGCCTGCTCACGTCGGTGCAAAAGAATATAGTCTGGGCAACCGAGGGCGCCACGTTTGCCACTAGCCGGC
CCGAGAGCGCCATCTATCTCGGACTGGTGCGCGTCGCCAGCTCAGAAAACGATGCCTTGCGCGCCCTCGTCTTTG
ACTTTGCCGCCGAGTCGCCAGCCTCGTCCATTGCGGCCAACTTGGTGCGGCTGCTGGACACGGGGATTGCCGAGG
GAGAGGTGGCGGAGCAAGAGGGCATCATTTATATTCCGCGCGTGGAGGCCGACGACGAGCGCAACTGCAAGCTGA
CAAACGGACCGAACCAAGAGCCGCGGCTGGAGCCGTTTGGCACGCCAGACACGCAGACGGCGCTGGCGTTGCGCA
TTGGCAAGGTTGGACTGTTGGAAACGCTGCATTTTGGCCAAGACGAACAAGTCGAGGACACGGAGCTTGGAGACG
AGGATGTCGAGGTGGAAACACGGGCTTCGTCTATTAATTTCCGCGACGTGGCGGCCAGCATGGGCATCATTGAGG
ACTCGGAGCTTGGCGACGAATGCGCGGGCCTGTGCACCCGAGTCGGCTCCCGTGTCACGGGCTTCAAGGCTGGGG
ACCGCGTCGTTGCTCTGCGGCCGGGCCAGGGCGCACATAGAAGCCTGGTGCGCAATCCTGCTTCCTGGTGCTACA
AGCTGCCAGAGAGCATGTCTTTTGTTGAAGCAGCCGCCATGCCGCTAATCCTGGGCACGGCGTGGTTTGCCCTTG
ACCACACTGCTCGGTTGGCCAGAGGGGAAACGCTGCTCATTCATGCGGCGGCGGGAGGCGTGGGGCAAATGGCCA
TTCAGATTGCCCAGGGCGTGGGTGCGCGCATCTTGGCCACGGTGGGCTCGCCGGCAAAGCGGCAGCTCCTCAAGG
ACACGTATGGGCTGGCCGATGAGCAGATATTCTCTTCGCGCAACGACTTGTTTGTCAAGGGCGTCATGGGGGCGA
CGGGCGGGCGCGGTGTGGATGTGGTGCTCAATAGCCTGGCTGGCCCGCTGCTCCACGCCTCGTGGGCCTGTCTGG
CGCCCTTTGGCCGCTTTGTCGAGATTGGCAAGCGCGACATTCACGAGAATGCCAGCATCTCCATGGATCCCTTTA
GACGCAACGTGCTCTTTGCCTCGATTGACCTTGTCACCATGTTTGAGCAAAACAAGCCGCTGGGCGCGAGGCTCT
TCAAGGAGTGTTTTGACCTTATTGCCAGCGGCAAGATTAAAGCCCCCGCCACCATTAGGCAATTCTCGTATGCCG
AGCTTGTAAAGGGCTTTCGAATGCTGCAAATGGGGAGGCACACGGGAAAGATTGTTCTCGTGCCGCATGCCGAGG
ACATGGTGCCCGTGCTGCGCAGCGGCTACCGCAACACCAAGCTCTTTTCCGCAGAAAAGACGTATCTTCTTGTTG
GTGGGCTTGGCGGGCTGGGACGGACTCTGTCGCAGTGGATGGTGCGCAAAGGCGCCACCAAGCTGGCCTTTTTGT
CTCGCTCTGGCGCTGACAAGCCCGAGGCAAAAGTGACGATGCAATGGCTTATTGAGCGTGGCATCAGCGTTGGCA
TCTACCGCGGAGACGTTTCCCAAGCATGCCATGTTGCTGCCTGTGTTGACAGCATTGGCTCCAGCTTGGGAGGCC
TTTTCCAAGCCGCCATGGTGCTGCACGACAAGCCGCTCGAGACCATGACGCACGCACAATGGCAGAGCTGCTGTC
TGCCCAAGGTTGAGGGCACGCGCAACCTGCACCAGGCAACGCTGGGCCGCAAGCTCGATTTCTTCATAAGCTTCT
CCTCTGTAGCCTGCATCGTCGGGTCCAAGGGCCAGGCCAACTACGCGGCGGCAAACTGCTTCCTCGACGCCTTGA
TGCGCCATCGCAGGCAAGCAGGGCTGGTGGGCACGAGCATCAATGTCGGGGCGGTGACGGGGGTGGGTGTCGTTG
CCGAGAACGAGGAGCTGCATAAGAAGCTGCTCCGCATGGGCATGGACACGATTAACGAGCAAGAGCTGCTCTACC
AGGTGGAGGAGGCAGTCTTGGCTAATGGTACGCTGGCCTCGTTGACGCCTCGGGGCTGTACTGCGCACCAGATTA
TTAGCGGCGTGGGCCTCGTCTCTCCAAATATATACTGGGCATCCAAGCCCATGATGAAGAATCTCTACGTCAACC
ACGACTTTGGCGGGGATGGGGCCGCCGACCAGACACAGAAGAATCTCTTGGCCATTTTGAAGAATGAGCCCGAAA
TGGACAAGAGGCTGGCGCTGCTGCTGGACGGATTCCTCGACAAGATTGCCGAGGTGCTGGCGACGCCTCGAGAGT
CCATCTTGGCCAGCAGTCCGTTATCGGCCTATGGTCTCGACTCGATTGTGGCCGTCGAGTTTCGCAAGTGGTTCC
GCAACGAGGTGCAGGTTGACATTGCCCTCTTTGACATTTTGGGTGCCGCGTCGATTAATGCTCTCGTCTCCAAAA
CGGTACGAATGATGGCCAAGAGCCCATTGGCCAAGGAGACGGTAGTCAAGAGCCACGCGGCAAATGACCAGACGG
CGAGCCGGGTGGAGGTGGAGGGCCCCAGCGACAAGACGGTAAACTCGGCCATGGCCAGCGGCGAGCTCACCAAGG
CGAGTGCGGAGGGCGCCAGTCCCCTGTCCACGTTTCAGTCGCGGCTGTGGTTTGTGCACAGCTTTCTCGACGACA
AGTCGCTGCTTAACCTGCCCGTGGTGCTTCACATGAGGGGCAAGCCCGACCACGCCAGCTTGCAGACTACGCTGC
GGGAGCTGGCGTGGCGGAATCCGGTGCTGCGGTCGGCCTATTTCGAGGGAGAGGAGTGTAGCATGCAGCAGCCCA
TGGACGACTTTGAGCTCGACCTCGACTACCAAGACTTTTCGTGCATTTCCTATGCCAGCACAGAGCAACAGGCCA
AGTCGAGCGACCAGGCAAGCAAGGCAAAGCAGGCGCTGCTCGGCGAGCTGCTGCAGCACAAGCGGCTCATGGAGA
TGAATGTCGACGAGGGCCAAGTAGCCAGCTTTTGCCTCGTCAAGCTCAGCGACCTTGAATGGGCCATGGTGGCGG
TGGCACACCACATGTCGATTGACCGGGGCAGCCTCTTCCCCATGATGTCGCAATTCGTCGCCATTTACGACGCGG
TGCGGGCCAAGACGGACCTGGCCTTTGTTGCCGCGCCCGAGTTTGACTATGTCGATTTCACGCTCTGGCACAATG
CGCGGCTGGCGTCGGACCTGATGAAGCCTGATCTCGAGTGGTGGCGTCGCACGCTAGAGGGCGTGGCGCAAAGTA
GCAAGCTGTTGCCCTTTGCGCGCTTTGAGCAGCGCCCGGCGAGGGGGGAGCCGCAGCGGGAAAAGGTGCGCACGA
CAATCGAGGCCAACATGTTTGCTCGCATGAAGCGGATATCGGCGCAGTCGGGCGCAACGCCCTTTCACTTTGTCC
TGGCGGCCTTTCGCGCCTTTATCTATCGCTATACCGAGGAAAAGGACGTGGTGCTGCTCATGGTTGATGGCAACC
GGCCGCATCCAGACACTGAGTCGCTAGTTGGGTTTTTTGTCAATCTGGCTCCTGTTCGATGCAATGGTGTGTGTG
TGTGTTTTTTTTTTTTTTTTTTTTTTTTCATGGAGTTCTAAGCAAGTGAGTGGTTTGATGCTAATGATGGGTCAA
AAAAATAGACGACTGCGACGTGCCATTTGACCAGTTATTCCAAGCCACCAAGCGGCGCGCTCTCGACGCCATGGC
CCACAGCGGCGTCCCCTTTGACACCATTGTCGACATTGTCAAGGCGCAAAAGACGAGCAGCCACATGCCGCTCGG
CCAAATTGCCGTCAACTACCAGATCCACGGCCCAGCACCAGCCTACCAGACAGTCGACTTTGTCGTTGACGACAT
TACGTCGAGCGACATTCCCACGGCGGCCGAGATGCAGCTCGAGGCCATTGAGACGTCGCAGCACTGTCTAGACCT
CAAGATTGAGTATGCGACGCTGCTCTACTCCGACGCCGACATGGAGCGCTTCGTGGACAACTTTGGCGTCTTTTT
GACGAATTGCATTCGCGACCATCGCCAGCCCGTGGATGAGATTGCCATGTGTGGGCCGCTAGAGATGGACTTGTT
GGGCTCGCGGTATTGGAATACGCAGACGCGAGAGAATCAGTGGCAGCGGCGCAGCGTGCTCGACGTGATTGCCAG
CCAGCAGCCTCTGGCAGTAGCCATTAACACCTCGGACGGCGACGCCATGTCGTACCAAGAACTCATGCAAAATGC
ATCAAGTCTTGCTGCTGCGCTGCTCGACGCTGGGCTTGTTCCGGGGCAGTGCATCGGAGTAGTAGCTCTGCCGGG
CGTCGAGGCCATTGTTGCCGTCTTGGGCATCCTCATGCTTGGCGCGTGCTACGTTGCGCTTGATGTCGACTTTGC
AGAGGACCGGCTCGCCTTTATGGTCAAGGACTCGAGGGCCGCGGCTCTAGTCGTGGGCAAGGAGCATGAGGGGCT
GGCGGCTAGGCTGGCGGCCAAGAGTGTAGGAGGGGCGCCAGTCGTGCTGAGGGTTGATGAGGCGTGTGCTCGAGC
CGGTTGTTTGGCGCGGCAGAGACCGAGGCAGCCCCAGGATCCCTTTTACATGATTTACACATCGGTGAGTCTGTT
TTTGAAAATAGAAATGGAGCGTTTCAAGTTGAAAGCAGCTGACATGATTTTTTCTTCTTCTTCTTTCCTGCAGGG
AAGCACCGGCACGCCAAAGGGCGTCGTGTTGAGTGAAGCAAATACGCAGGCCATGCTTGCTTCGCTCAACAAGCA
TCTCGACTTTGGGCACACCGACGTCTTTCTCGCCCACACCACCATGGCCTTTGACCTTTCCGTCGTGCAAATCTT
TGGCGCCCTAACAGCCGGCGCCACCGTCTCGCTTGCCTCGTGGGAGACGCGCAAGGACCCTGCTGCTCTGGCCCG
CTTCATGGAGCAGCAGGGCGTCAGCGTCACATACTTTACTCCAACGCAGTACTCTCTCCTCGTCGAAGCCAACTC
TGGCGCGCTGAGGCGGTGCTCCAAGTATAGAGTCGCGCTATTTGCTGGAGAGCGGCTTCCCGTTCGTCTGGTTAG
GGCATTTTTCCACCTTGGTCTTGGCGCGAGCCTTTACAACACTTGGGCGCCCTCTGAACTCGTGGTGCAGACGAC
GCTGGCAAAGATTGATGCTCCACCACAGGGCGTCGTTAGCCTGCCCATTGGCTATCCCTTGGATAACTGCCGTCA
CTACATTGTCGACGCCAGAGGTGAGCCTGTGCCCTGCGGCCACGTCGGAGAGCTGGTTGTTGGCGGAGCTCAAGT
CGGAGTTGGCTATCTGCATCGGCCCGAGCTAAACGCACAATTCTTTGTGCGCAATGTCTTTGCCTCGGACGACGA
TTGCAGGCGTGGCTGGACGCGCATGTTCAAGACGGGCGACAGGGGCCGTTTTCGTCCCGACGGACAGCTCGAGTT
TCACGGACGCATTGCTGGCGACAAGCAAATCAAGCTGCGTGGCTTCCGTCTTGATTTGGGCGAGGTGGAGCACGT
CTTGTTTCGGGAATCGCAGCTGCTGTACACGGGGGCACTGGCTGATATTGCCGTTGTGGCGCGCACTGTCGAGTC
TGGAGACACACAGCTCGTTGCCTTTATCCTCCTCAGGGACAAGATGGTGCAAGGCGCGGCCAAGGCGGCTGTCGT
TTCGCGCCTCCATCAAAGCGTCAAGCCGCACCTTAATCACTACATGCTTCCCAGCGGCTATCAGTTTATTGACCA
GTTGCCACTCACAATAGGCGGCAAGGTCAACCGCCGTGAGCTTCTTGAGCGTCGGCTGGACCTGGTTTACCCTTC
ATCGGTCACGACGAGGCTCAAGGAGTCACACGCGGCTGATTTGAGCGAGGCTTGTGCGCCAGCCGTCGATCATCT
CGACAAGTCTGTCATTGCTCTCTTCCAAACCGTCTTGGGCGGCGTCCAAGTGCGCCTGCACGACTCCTTCTTTGA
CCGCGGCGGCAACAGCATCTTGCTTATCCGTCTCCATGCAAAAATCAAGCGCAAATTCAAGCTTGCTCCCCCGCT
GCCGGCGCTCATTCGACAGCCCACAGCGGCTGCTGTATGCGCCTATATTCGCAGCGGAGGCGGCACAGCAGATGT
GCAAAGCAATAGAGCCATGATTAACTGGAAGACGGAGACAAATCTCCCCAACATGAGCCAGTACATGCCGCACTT
TGACGCTCTGTCACTGGTGCAAAACTTTGCAGAGTTTGGAGCAGTGCTTCTGACGGGAGCAGAGACATTTATAGG
TGTTCATGTTTTGGCTGCTCTGCTGCGCAACAAGGCCGACGTGACTGTTCATGTCGTGGGCTCCATGCAAAGACT
CGAGTTTGCCCCGCTACTGCATCTTCTCGCCAAGCATCAGCTACTCGACCAAGACGGTCTCGACGCAGACCAGGT
AACTCGTCGCGTCTGCCTGGTGCCTGGGGCGCTTAGCGAGCCCAACCTGGGCCTCTCACGGTCCGCCTTTGGCAG
CCTCGGTGCCGCCGTGGATGCCATTTACCACCTTGGCGGCCACGTCTCGCTCCTAAAGCCCTACTCGGCGCTGCG
GCGGCTCAACGTGGCGCCCGTGCTCGACATGATTCGTCTGGCTGGCTGCGGGCGACGCGTCTCAGCGCTGCACTA
CCTCTCGACATGGTCTGTTGCTCATTTGCAAACATGGACGGGCGCAACGCGAACGCGTGACGACTATGTGACAGC
CGAAGAGCCATGCACGCATTTTACGCCGCCGACAGACGACGCGGCAGGCTACTTCAAGACGCGGTGGGTGGCTGA
GAGTCTGCTGGTTGAAGCAGCGCGGAGGGGGTTTCCAGTCACGATTGTGCGCGCGTCGGCAGTGACTGCGGCCCG
GGCAGATGGCGGCGCCGCAGGGGACGTGCTGGATCCGGCAGACGAGCTCACGATGCGCATGGTGGTGGACATGGT
TGACTCGGGCACAGTGCCGAGCATTGGGCGCGACGATCAGCCTGGCTTTGCCATTGATGTGGTTCCTGTCGACTG
GCTTGCAGAGAGCCTGGTTGCTTTGACGACGAGGAGCCGGCACAAGGCGGCTTGTCCCTCTACCGCTGCTGCGGC
ATCATCAAGCCCGACGCCGAGTCTGCACATTTTCCACCTTTCGAATCCGCAGCCCCTTGCGCTACGACGTCTTCC
TCTAATCATTGCCCAGCTGCGTCCCGGGCATGGACAGCTCATATCTCTGAGCGAGTGGCTTGCAACCATGGCAGC
CCAGGGCCAAGACGACGCGAGCCAACGAGCGCGAAACGAAGCGGTGCGTCAGACGCTCGAGACGGGTTCCGTCAT
GTTTAGTCTGCAAAATACATGGACCATGGGTGTCTTGGAGGAGCAGAGGCCGGGGCTGGTGGCAAAGTGTCCTGC
AGTGGATGCAGTGTTTTTAAAGGCCTTGTGGGAGAGAATGGGACGAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail