Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5405
Gene name
LocationContig_41:45029..46220
Strand-
Gene length (bp)1191
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02374 ArsA_ATPase Anion-transporting ATPase 1.8E-108 26 336
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 2.1E-12 28 217
PF13614 AAA_31 AAA domain 1.9E-11 31 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870U4|GET3_NEUCR ATPase get3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|A6S7T2|GET3_BOTFB ATPase get3 OS=Botryotinia fuckeliana (strain B05.10) GN=get3 PE=3 SV=1 1 342 0.0E+00
sp|A7EHP6|GET3_SCLS1 ATPase get3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get3 PE=3 SV=1 1 342 0.0E+00
sp|B6Q334|GET3_TALMQ ATPase get3 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|Q2GXW1|GET3_CHAGB ATPase GET3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET3 PE=3 SV=1 1 342 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870U4|GET3_NEUCR ATPase get3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|A6S7T2|GET3_BOTFB ATPase get3 OS=Botryotinia fuckeliana (strain B05.10) GN=get3 PE=3 SV=1 1 342 0.0E+00
sp|A7EHP6|GET3_SCLS1 ATPase get3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get3 PE=3 SV=1 1 342 0.0E+00
sp|B6Q334|GET3_TALMQ ATPase get3 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|Q2GXW1|GET3_CHAGB ATPase GET3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET3 PE=3 SV=1 1 342 0.0E+00
sp|A4QUI2|GET3_MAGO7 ATPase GET3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET3 PE=3 SV=1 1 343 0.0E+00
sp|B8M4Y9|GET3_TALSN ATPase get3 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|A5AAA1|GET3_ASPNC ATPase get3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|C4JZ54|GET3_UNCRE ATPase GET3 OS=Uncinocarpus reesii (strain UAMH 1704) GN=GET3 PE=3 SV=1 1 344 0.0E+00
sp|A6QRP2|GET3_AJECN ATPase GET3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|C6HRP6|GET3_AJECH ATPase GET3 OS=Ajellomyces capsulatus (strain H143) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|C0NV23|GET3_AJECG ATPase GET3 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|Q1E167|GET3_COCIM ATPase GET3 OS=Coccidioides immitis (strain RS) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|Q0CNR4|GET3_ASPTN ATPase get3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=get3 PE=3 SV=1 2 342 0.0E+00
sp|A1D6T7|GET3_NEOFI ATPase get3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|Q2UKT0|GET3_ASPOR ATPase get3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|B8N3P7|GET3_ASPFN ATPase get3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=get3 PE=3 SV=2 1 343 0.0E+00
sp|Q4WY07|GET3_ASPFU ATPase get3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=get3 PE=1 SV=2 2 343 0.0E+00
sp|B0XXL5|GET3_ASPFC ATPase get3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|A1CKN5|GET3_ASPCL ATPase get3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|B2VVF0|GET3_PYRTR ATPase get3 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=get3 PE=3 SV=1 2 343 0.0E+00
sp|Q5B971|GET3_EMENI ATPase get3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=get3 PE=3 SV=1 2 342 0.0E+00
sp|B6H443|GET3_PENRW ATPase get3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|B2B7D9|GET3_PODAN ATPase GET3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GET3 PE=3 SV=1 1 342 0.0E+00
sp|C5JUG0|GET3_AJEDS ATPase GET3 OS=Ajellomyces dermatitidis (strain SLH14081) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|C5G9V3|GET3_AJEDR ATPase GET3 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GET3 PE=3 SV=1 2 344 0.0E+00
sp|C5P9K5|GET3_COCP7 ATPase GET3 OS=Coccidioides posadasii (strain C735) GN=GET3 PE=3 SV=1 2 330 3.0E-180
sp|C5FD58|GET3_ARTOC ATPase GET3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GET3 PE=3 SV=1 2 344 3.0E-177
sp|Q0UP11|GET3_PHANO ATPase GET3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GET3 PE=3 SV=2 2 329 1.0E-176
sp|C1GTV2|GET3_PARBA ATPase GET3 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GET3 PE=3 SV=1 2 344 2.0E-175
sp|C0S3F7|GET3_PARBP ATPase GET3 OS=Paracoccidioides brasiliensis (strain Pb03) GN=GET3 PE=3 SV=1 2 344 4.0E-175
sp|C1G182|GET3_PARBD ATPase GET3 OS=Paracoccidioides brasiliensis (strain Pb18) GN=GET3 PE=3 SV=1 2 344 4.0E-175
sp|Q4P7S5|GET3_USTMA ATPase GET3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GET3 PE=3 SV=1 1 344 3.0E-155
sp|A8N0V8|GET3_COPC7 ATPase GET3 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET3 PE=3 SV=1 8 344 1.0E-149
sp|P0CM24|GET3_CRYNJ ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET3 PE=3 SV=1 10 343 9.0E-148
sp|P0CM25|GET3_CRYNB ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET3 PE=3 SV=1 10 343 9.0E-148
sp|A8Q0M1|GET3_MALGO ATPase GET3 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=GET3 PE=3 SV=1 7 343 1.0E-144
sp|B6K052|GET3_SCHJY ATPase get3 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=get3 PE=3 SV=1 11 340 5.0E-144
sp|B0CPJ0|GET3_LACBS ATPase GET3 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GET3 PE=3 SV=2 12 343 2.0E-143
sp|Q6C3M9|GET3_YARLI ATPase GET3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET3 PE=3 SV=1 14 339 2.0E-139
sp|B2DFU2|GET3_RHOGU ATPase GET3 OS=Rhodotorula glutinis GN=GET3 PE=3 SV=1 2 339 3.0E-138
sp|Q9P7F8|GET3_SCHPO ATPase get3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get3 PE=1 SV=1 10 342 2.0E-137
sp|C4R7S9|GET3_PICPG ATPase GET3 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GET3 PE=3 SV=1 13 339 8.0E-118
sp|Q0IIZ2|ASNA_XENTR ATPase asna1 OS=Xenopus tropicalis GN=asna1 PE=2 SV=1 10 342 2.0E-116
sp|A7RQM5|ASNA_NEMVE ATPase ASNA1 homolog OS=Nematostella vectensis GN=v1g161623 PE=3 SV=1 10 341 1.0E-115
sp|Q6GNQ1|ASNA_XENLA ATPase asna1 OS=Xenopus laevis GN=asna1 PE=2 SV=1 10 342 2.0E-114
sp|Q6IQE5|ASNA_DANRE ATPase asna1 OS=Danio rerio GN=asna1 PE=1 SV=1 10 344 5.0E-114
sp|Q5TRE7|ASNA_ANOGA ATPase ASNA1 homolog OS=Anopheles gambiae GN=AGAP005782 PE=3 SV=3 10 341 9.0E-114
sp|B4N645|ASNA_DROWI ATPase ASNA1 homolog OS=Drosophila willistoni GN=GK17805 PE=3 SV=1 10 342 2.0E-113
sp|O54984|ASNA_MOUSE ATPase Asna1 OS=Mus musculus GN=Asna1 PE=1 SV=2 10 342 2.0E-113
sp|O43681|ASNA_HUMAN ATPase ASNA1 OS=Homo sapiens GN=ASNA1 PE=1 SV=2 10 342 2.0E-113
sp|A5PJI5|ASNA_BOVIN ATPase ASNA1 OS=Bos taurus GN=ASNA1 PE=2 SV=1 10 342 2.0E-113
sp|B4QEC4|ASNA_DROSI ATPase ASNA1 homolog OS=Drosophila simulans GN=GD10240 PE=3 SV=1 10 344 2.0E-113
sp|B0WEV5|ASNA_CULQU ATPase ASNA1 homolog OS=Culex quinquefasciatus GN=CPIJ005690 PE=3 SV=1 10 341 5.0E-113
sp|A5DVY5|GET3_LODEL ATPase GET3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GET3 PE=3 SV=1 12 344 6.0E-113
sp|A5DGM1|GET3_PICGU ATPase GET3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GET3 PE=3 SV=2 9 344 8.0E-113
sp|B4LN33|ASNA_DROVI ATPase ASNA1 homolog OS=Drosophila virilis GN=GJ21093 PE=3 SV=1 12 343 1.0E-112
sp|B4J4F6|ASNA_DROGR ATPase ASNA1 homolog OS=Drosophila grimshawi GN=GH21552 PE=3 SV=1 12 343 1.0E-112
sp|A3LX15|GET3_PICST ATPase GET3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GET3 PE=3 SV=1 9 341 2.0E-112
sp|C4Y7U0|GET3_CLAL4 ATPase GET3 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GET3 PE=3 SV=1 9 341 2.0E-112
sp|Q7JWD3|ASNA_DROME ATPase ASNA1 homolog OS=Drosophila melanogaster GN=CG1598 PE=2 SV=1 10 344 4.0E-112
sp|B3N9X2|ASNA_DROER ATPase ASNA1 homolog OS=Drosophila erecta GN=GG10733 PE=3 SV=1 10 341 7.0E-112
sp|B3MHB7|ASNA_DROAN ATPase ASNA1 homolog OS=Drosophila ananassae GN=GF11712 PE=3 SV=1 10 341 8.0E-112
sp|B4KTG7|ASNA_DROMO ATPase ASNA1 homolog OS=Drosophila mojavensis GN=GI19524 PE=3 SV=1 12 343 8.0E-112
sp|B4P1R6|ASNA_DROYA ATPase ASNA1 homolog OS=Drosophila yakuba GN=GE23838 PE=3 SV=1 10 341 8.0E-112
sp|Q6BSM0|GET3_DEBHA ATPase GET3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GET3 PE=1 SV=1 9 341 8.0E-112
sp|C5MF33|GET3_CANTT ATPase GET3 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GET3 PE=3 SV=1 9 341 2.0E-111
sp|Q16MG9|ASNA_AEDAE ATPase ASNA1 homolog OS=Aedes aegypti GN=AAEL011136 PE=3 SV=1 10 341 2.0E-110
sp|B4H8J5|ASNA_DROPE ATPase ASNA1 homolog OS=Drosophila persimilis GN=GL20106 PE=3 SV=1 10 341 3.0E-110
sp|A8WNH9|ASNA_CAEBR ATPase asna-1 OS=Caenorhabditis briggsae GN=asna-1 PE=3 SV=1 8 339 6.0E-110
sp|Q28YJ2|ASNA_DROPS ATPase ASNA1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14038 PE=3 SV=1 10 341 1.0E-109
sp|P0CB55|GET3_CANAW ATPase GET3 OS=Candida albicans (strain WO-1) GN=GET3 PE=3 SV=1 9 341 1.0E-109
sp|P0CB54|GET3_CANAL ATPase GET3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET3 PE=3 SV=1 9 341 1.0E-109
sp|B9W757|GET3_CANDC ATPase GET3 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GET3 PE=3 SV=1 9 341 1.0E-109
sp|B4HR35|ASNA_DROSE ATPase ASNA1 homolog OS=Drosophila sechellia GN=GM20779 PE=3 SV=1 10 344 5.0E-109
sp|Q8T662|ASNA_DICDI ATPase ASNA1 homolog OS=Dictyostelium discoideum GN=arsA PE=1 SV=1 8 341 2.0E-108
sp|A8Q3T2|ASNA_BRUMA ATPase ASNA1 homolog OS=Brugia malayi GN=Bm1_42140 PE=3 SV=1 9 339 9.0E-108
sp|P30632|ASNA_CAEEL ATPase asna-1 OS=Caenorhabditis elegans GN=asna-1 PE=1 SV=1 10 339 1.0E-107
sp|A7TH32|GET3_VANPO ATPase GET3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GET3 PE=3 SV=1 9 341 9.0E-107
sp|Q12154|GET3_YEAST ATPase GET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET3 PE=1 SV=1 9 341 1.0E-106
sp|A6ZXM9|GET3_YEAS7 ATPase GET3 OS=Saccharomyces cerevisiae (strain YJM789) GN=GET3 PE=3 SV=1 9 341 1.0E-106
sp|B3LGZ3|GET3_YEAS1 ATPase GET3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GET3 PE=3 SV=1 9 341 1.0E-106
sp|Q759J2|GET3_ASHGO ATPase GET3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GET3 PE=3 SV=2 13 341 3.0E-106
sp|Q6CPX3|GET3_KLULA ATPase GET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GET3 PE=3 SV=1 9 341 6.0E-106
sp|Q6FKZ9|GET3_CANGA ATPase GET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GET3 PE=3 SV=1 9 341 3.0E-104
sp|C5DQ05|GET3_ZYGRC ATPase GET3 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GET3 PE=3 SV=1 9 341 4.0E-103
sp|C5DL53|GET3_LACTC ATPase GET3 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GET3 PE=3 SV=1 13 341 1.0E-102
sp|A0E7A5|ASNA2_PARTE ATPase ASNA1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00023900001 PE=3 SV=1 12 343 2.0E-101
sp|A0BZ55|ASNA1_PARTE ATPase ASNA1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00033675001 PE=3 SV=1 10 343 1.0E-99
sp|Q4CNH2|ASNA_TRYCC ATPase ASNA1 homolog OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053507763.30 PE=3 SV=1 11 339 4.0E-89
sp|Q8I1T8|ASNA_PLAF7 ATPase ASNA1 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0725c PE=3 SV=1 8 342 5.0E-82
sp|B9PGU1|ASNA_TOXGO ATPase ASNA1 homolog OS=Toxoplasma gondii GN=TGVEG_231190 PE=3 SV=1 9 342 1.0E-81
sp|Q4YVP3|ASNA_PLABA ATPase ASNA1 homolog OS=Plasmodium berghei (strain Anka) GN=PB000618.02.0 PE=3 SV=1 9 342 3.0E-81
sp|Q7RMI2|ASNA_PLAYO ATPase ASNA1 homolog OS=Plasmodium yoelii yoelii GN=PY02198 PE=3 SV=1 9 342 5.0E-81
sp|A5K5W9|ASNA_PLAVS ATPase ASNA1 homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_089705 PE=3 SV=1 16 342 6.0E-80
sp|B3L1G8|ASNA_PLAKH ATPase ASNA1 homolog OS=Plasmodium knowlesi (strain H) GN=PKH_051870 PE=3 SV=1 16 342 1.0E-79
sp|Q4XST6|ASNA_PLACH ATPase ASNA1 homolog OS=Plasmodium chabaudi GN=PC000665.03.0 PE=3 SV=1 10 342 4.0E-79
sp|A3FPQ6|ASNA_CRYPI ATPase ASNA1 homolog OS=Cryptosporidium parvum (strain Iowa II) GN=cgd7_4070 PE=3 SV=1 1 322 2.0E-78
sp|B0EHY7|ASNA_ENTDS ATPase ASNA1 homolog OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_044870 PE=3 SV=1 15 333 5.0E-78
sp|C4LY44|ASNA_ENTHI ATPase ASNA1 homolog OS=Entamoeba histolytica GN=EHI_177400 PE=3 SV=1 15 333 5.0E-77
sp|A8B3G9|ASNA_GIAIC ATPase ASNA1 homolog OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_7953 PE=3 SV=1 14 339 3.0E-76
sp|A4H6J5|ASNA_LEIBR ATPase ASNA1 homolog OS=Leishmania braziliensis GN=LbrM11_V2.0490 PE=3 SV=1 12 341 2.0E-75
sp|Q4QH08|ASNA_LEIMA ATPase ASNA1 homolog OS=Leishmania major GN=LmjF11.0700 PE=3 SV=1 12 341 7.0E-75
sp|A4HUY0|ASNA_LEIIN ATPase ASNA1 homolog OS=Leishmania infantum GN=LinJ11.0710 PE=3 SV=1 12 341 8.0E-75
sp|A7AW49|ASNA_BABBO ATPase ASNA1 homolog OS=Babesia bovis GN=BBOV_I001930 PE=3 SV=1 5 341 6.0E-72
sp|Q4N0J4|ASNA_THEPA ATPase ASNA1 homolog OS=Theileria parva GN=TP03_0142 PE=3 SV=1 12 341 2.0E-62
sp|O27555|ARSA_METTH Putative arsenical pump-driving ATPase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1511 PE=1 SV=1 27 335 1.0E-52
sp|Q58542|ARSA_METJA Putative arsenical pump-driving ATPase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1142 PE=1 SV=1 42 335 6.0E-52
sp|O52027|ARSA_HALSA Putative arsenical pump-driving ATPase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsA PE=2 SV=1 1 335 8.0E-32
sp|O66908|ARSA1_AQUAE Putative arsenical pump-driving ATPase 1 OS=Aquifex aeolicus (strain VF5) GN=arsA1 PE=3 SV=1 25 344 3.0E-30
sp|Q46465|ARSA_PROVB Putative arsenical pump-driving ATPase OS=Prosthecochloris vibrioformis PE=3 SV=1 25 332 3.0E-30
sp|Q46366|ARSA_CHLTE Putative arsenical pump-driving ATPase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1945 PE=3 SV=2 25 332 7.0E-30
sp|P52145|ARSA2_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=3 SV=1 27 277 5.0E-28
sp|O66674|ARSA2_AQUAE Putative arsenical pump-driving ATPase 2 OS=Aquifex aeolicus (strain VF5) GN=arsA2 PE=3 SV=1 39 335 8.0E-28
sp|P08690|ARSA1_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=1 SV=1 27 290 7.0E-27
sp|O50593|ARSA_ACIMA Arsenical pump-driving ATPase OS=Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU301) GN=arsA PE=3 SV=1 27 290 7.0E-27
sp|Q55794|ARSA_SYNY3 Putative arsenical pump-driving ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0086 PE=3 SV=1 25 341 1.0E-24
sp|O52027|ARSA_HALSA Putative arsenical pump-driving ATPase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsA PE=2 SV=1 17 331 4.0E-23
sp|O50593|ARSA_ACIMA Arsenical pump-driving ATPase OS=Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU301) GN=arsA PE=3 SV=1 28 331 7.0E-10
sp|P52145|ARSA2_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=3 SV=1 28 331 1.0E-09
sp|P08690|ARSA1_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=1 SV=1 7 183 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5405
MSTAVISADEALEPTLQTLLDQRSLRWIFVGGKGGVGKTTTSCSLAIQLARVRRSVLLISTDPAHNLSDAFSQKF
GKEARLVNGFDNLSAMEIDPNGSMQDLLAGQGEQDAGNELGAMAGGLGGMMQDLAFAIPGIDEAMSFAEVLKQVK
SLSYETIIFDTAPTGHTLRFLQFPSVLEKALAKVSQLSSQYGPLLNGFLGSNGTLPNGQNLNDMMEKLESLRETI
SEVNTQFKDAQLTTFVCVCIAEFLSLYETERMIQELTTYGIDTHTIVINQLLFPKKSSQCDQCNARRKMQKRYLD
QYEELYAEDFHLVKMPLLVDEVRGKEKLQNFSELLIHPHVPPEE*
Coding >OphauB2|5405
ATGTCGACGGCGGTAATCTCGGCCGACGAGGCTCTGGAGCCAACCCTGCAAACCCTTCTTGACCAGCGCTCGCTG
CGCTGGATCTTTGTCGGCGGCAAAGGCGGCGTGGGCAAAACCACCACGTCGTGCTCGCTGGCCATTCAGCTGGCG
CGCGTGCGGCGCTCCGTCTTGCTCATTAGCACGGACCCGGCGCATAACCTCTCTGATGCGTTTTCGCAAAAATTC
GGCAAAGAGGCGCGTCTGGTGAATGGGTTTGATAACCTGAGTGCCATGGAGATTGATCCAAATGGCAGTATGCAG
GATTTGCTTGCCGGGCAGGGCGAGCAGGATGCTGGGAATGAGCTGGGGGCCATGGCGGGGGGGTTGGGTGGCATG
ATGCAGGATCTTGCCTTTGCGATTCCTGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAGGTCAAG
TCGCTCTCGTACGAAACAATAATCTTTGACACGGCGCCCACGGGCCACACGCTTCGCTTTCTTCAGTTTCCCTCG
GTTCTCGAAAAAGCCCTGGCCAAGGTGTCGCAGCTCTCATCCCAATACGGGCCTCTGCTCAACGGCTTCCTCGGC
TCAAACGGCACGCTGCCCAATGGCCAAAACCTAAACGACATGATGGAAAAGCTCGAATCCCTCCGCGAAACCATT
TCCGAAGTCAATACCCAATTCAAGGACGCCCAGCTCACCACCTTTGTCTGCGTCTGCATCGCCGAATTCCTCTCC
CTCTATGAAACTGAACGCATGATTCAGGAATTAACAACATATGGCATCGACACCCACACCATTGTCATTAACCAG
CTCCTCTTTCCCAAAAAGTCGAGCCAGTGTGATCAGTGCAACGCCCGCCGCAAAATGCAAAAGAGATATCTCGAT
CAGTACGAGGAGCTATACGCCGAGGACTTTCACCTGGTAAAGATGCCGCTGCTGGTTGACGAGGTTCGCGGCAAG
GAGAAGCTTCAGAATTTTAGCGAGCTCCTGATTCATCCCCATGTCCCGCCAGAGGAATAA
Transcript >OphauB2|5405
ATGTCGACGGCGGTAATCTCGGCCGACGAGGCTCTGGAGCCAACCCTGCAAACCCTTCTTGACCAGCGCTCGCTG
CGCTGGATCTTTGTCGGCGGCAAAGGCGGCGTGGGCAAAACCACCACGTCGTGCTCGCTGGCCATTCAGCTGGCG
CGCGTGCGGCGCTCCGTCTTGCTCATTAGCACGGACCCGGCGCATAACCTCTCTGATGCGTTTTCGCAAAAATTC
GGCAAAGAGGCGCGTCTGGTGAATGGGTTTGATAACCTGAGTGCCATGGAGATTGATCCAAATGGCAGTATGCAG
GATTTGCTTGCCGGGCAGGGCGAGCAGGATGCTGGGAATGAGCTGGGGGCCATGGCGGGGGGGTTGGGTGGCATG
ATGCAGGATCTTGCCTTTGCGATTCCTGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAGGTCAAG
TCGCTCTCGTACGAAACAATAATCTTTGACACGGCGCCCACGGGCCACACGCTTCGCTTTCTTCAGTTTCCCTCG
GTTCTCGAAAAAGCCCTGGCCAAGGTGTCGCAGCTCTCATCCCAATACGGGCCTCTGCTCAACGGCTTCCTCGGC
TCAAACGGCACGCTGCCCAATGGCCAAAACCTAAACGACATGATGGAAAAGCTCGAATCCCTCCGCGAAACCATT
TCCGAAGTCAATACCCAATTCAAGGACGCCCAGCTCACCACCTTTGTCTGCGTCTGCATCGCCGAATTCCTCTCC
CTCTATGAAACTGAACGCATGATTCAGGAATTAACAACATATGGCATCGACACCCACACCATTGTCATTAACCAG
CTCCTCTTTCCCAAAAAGTCGAGCCAGTGTGATCAGTGCAACGCCCGCCGCAAAATGCAAAAGAGATATCTCGAT
CAGTACGAGGAGCTATACGCCGAGGACTTTCACCTGGTAAAGATGCCGCTGCTGGTTGACGAGGTTCGCGGCAAG
GAGAAGCTTCAGAATTTTAGCGAGCTCCTGATTCATCCCCATGTCCCGCCAGAGGAATAA
Gene >OphauB2|5405
ATGTCGACGGCGGTAATCTCGGCCGACGAGGCTCTGGAGCCAACCCTGCAAACCCTTCTTGACCAGCGCTCGCTG
CGCTGGATCTTTGTCGGCGGCAAAGGCGGCGTGGGCAAAACCACCACGTCGTGCTCGCTGGCCATTCAGCTGGCG
CGCGTGCGGCGCTCCGTCTTGCTCATTAGCACGGACCCGGCGCATAACCTCTCTGATGCGTTTTCGCAAAAATTC
GGCAAAGAGGCGCGTCTGGTGAATGGGTTTGATAACCTGAGTGCCATGGAGATTGATCCAAATGGCAGTATGCAG
GATTTGCTTGCCGGGCAGGGCGAGCAGGATGCTGGGAATGAGCTGGGGGCCATGGCGGGGGGGTTGGGTGGCATG
ATGCAGGATCTTGCCTTTGCGGTGCGTTGGCTTTCCCCCTTTTGGCTTTTTTTTTTTGGTTTCTTTTCACGAGGG
CTCGTCTTTTGAGCTCTAGGAAGGGAAAGGGGGGCTCTTGTTTTGAGCTCTACAATGGGGAAGAAAAAAAAAACT
TGGCGCAGACTGACTCTTTGAGATTAGATTCCTGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAG
GTCAAGTCGCTCTCGTACGAAACAATAATCTTTGACACGGCGCCCACGGGCCACACGCTTCGCTTTCTTCAGTTT
CCCTCGGTTCTCGAAAAAGCCCTGGCCAAGGTGTCGCAGCTCTCATCCCAATACGGGCCTCTGCTCAACGGCTTC
CTCGGCTCAAACGGCACGCTGCCCAATGGCCAAAACCTAAACGACATGATGGAAAAGCTCGAATCCCTCCGCGAA
ACCATTTCCGAAGTCAATACCCAATTCAAGGACGCCCAGCTCACCACCTTTGTCTGCGTCTGCATCGCCGAATTC
CTCTCCCTCTATGAAACTGAACGCATGATTCAGGAATTAACAACATATGGCATCGACACCCACACCATTGTCATT
AACCAGCTCCTCTTTCCCAAAAAGTCGAGCCAGTGTGATCAGTGCAACGCCCGCCGCAAAATGCAAAAGAGATAT
CTCGATCAGTACGAGGAGCTATACGCCGAGGACTTTCACCTGGTAAAGATGCCGCTGCTGGTTGACGAGGTTCGC
GGCAAGGAGAAGCTTCAGAATTTTAGCGAGCTCCTGATTCATCCCCATGTCCCGCCAGAGGAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail