Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5404
Gene name
LocationContig_41:42258..44235
Strand+
Gene length (bp)1977
Transcript length (bp)1854
Coding sequence length (bp)1854
Protein length (aa) 618

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08783 DWNN DWNN domain 6.6E-31 5 78
PF13696 zf-CCHC_2 Zinc knuckle 2.0E-08 175 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94264|YORF_SCHPO Uncharacterized RING finger protein P8B7.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.15c PE=3 SV=1 1 354 3.0E-103
sp|P35728|MPE1_YEAST Protein MPE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPE1 PE=1 SV=1 1 357 2.0E-91
sp|Q7Z6E9|RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens GN=RBBP6 PE=1 SV=1 3 339 9.0E-35
sp|P97868|RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus GN=Rbbp6 PE=1 SV=5 3 339 2.0E-33

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5404
MSSSVFFKFKSQKEPTRVEFDGTGISVFELKREIISKSGLGDGTDFDLHIYTDDNSEEYDDDTTIVPRSTTVIAR
RQPAIKPGAGRAARYVSGKMPASAKNASRKEQASRANAAKSGSNAINQMNEAMTEEEKMEAMFAAQSEQWSAQQE
ELSHNAPAYKPGAKRPTNVPDHDPPNGYICYRCGNKGHWIQLCPTNDDPDFDNRPRVKRTTGIPRSFLQKIDKSA
ILAQTDGDETKRPSGIMVNADGDFVIAEPDKASWEQFQAKTKSSNKPTDAQATENKEVQDRGLECPIDKKMLIEP
MKTPCCNKTFCNDCITNALIESDFVCPACQTEGVLIDDLTPDEDCAKNIQEYLKKKETCADSPRPVSKSESDGKE
GENAELGKVTQNESELKDDKTTKKSKSPSPGPGNKSPAQEPKKSWPGTTTAPDKPSTDEAKAIEVKSTKRPAEDV
LENPKIPKAPKAMQSQQAANVMPNLNDMGNLNSMGMDNMMFGGCMGMMPPNMMGMQQNMGMNMGMNMGMMGMPMM
GMPGFGGINVGGFGALHSAWGINDMNPMNGMGMQNQQMNGPMSNGMGPGFFNGSGLMQTNGNEDDAYFRKPVNPH
RHQNKQRRVRPSDYREL*
Coding >OphauB2|5404
ATGTCGTCTTCAGTCTTTTTCAAATTTAAATCGCAAAAGGAACCGACGCGTGTCGAGTTTGACGGTACTGGCATA
TCCGTTTTTGAACTGAAGCGCGAAATCATCAGCAAGAGCGGCCTTGGTGACGGTACTGATTTTGATCTTCACATT
TACACTGACGACAATAGCGAGGAGTATGATGATGATACCACCATTGTCCCTCGCTCCACCACCGTCATTGCACGG
CGCCAACCTGCCATCAAGCCCGGTGCTGGGCGTGCTGCGCGGTATGTTTCGGGCAAAATGCCCGCATCAGCAAAG
AATGCCAGTCGCAAGGAGCAGGCATCGCGTGCAAACGCTGCCAAGTCTGGATCAAACGCCATTAACCAAATGAAT
GAAGCAATGACTGAAGAAGAAAAGATGGAGGCCATGTTTGCTGCCCAGAGTGAACAGTGGTCTGCCCAACAGGAA
GAATTATCACATAATGCACCAGCATATAAACCTGGTGCCAAGAGACCGACCAATGTCCCTGACCATGACCCCCCC
AACGGCTACATTTGCTATCGATGTGGCAACAAAGGCCATTGGATTCAGCTCTGCCCCACAAACGATGATCCCGAC
TTTGACAATAGACCTCGGGTTAAGCGCACCACTGGCATTCCGCGCTCATTTCTTCAAAAGATTGACAAGTCGGCA
ATCCTGGCGCAGACGGACGGAGACGAGACTAAGCGCCCCTCTGGAATCATGGTCAACGCGGATGGCGATTTTGTC
ATTGCTGAGCCTGACAAGGCTTCTTGGGAACAGTTTCAAGCAAAAACCAAGTCATCAAACAAGCCAACGGATGCC
CAGGCCACAGAGAACAAGGAGGTACAAGATCGCGGCCTAGAGTGCCCGATTGACAAGAAAATGTTGATAGAGCCA
ATGAAGACACCCTGCTGCAACAAGACGTTTTGTAATGATTGCATAACAAATGCTCTCATTGAAAGCGATTTTGTC
TGTCCTGCCTGCCAGACTGAAGGTGTCTTGATAGACGATTTGACGCCCGATGAAGATTGCGCAAAAAACATACAA
GAGTACTTAAAGAAGAAGGAGACTTGTGCTGATTCGCCTAGGCCAGTATCAAAATCTGAATCTGACGGCAAGGAA
GGGGAAAACGCCGAGCTCGGCAAAGTAACACAAAACGAGTCTGAATTAAAAGATGACAAGACGACCAAGAAGTCC
AAGTCGCCATCGCCAGGACCAGGCAACAAGTCGCCTGCCCAAGAGCCCAAGAAGTCATGGCCAGGTACTACGACA
GCTCCTGACAAGCCCAGTACGGATGAAGCAAAAGCGATAGAGGTCAAGTCGACTAAACGACCAGCAGAGGATGTG
CTTGAGAACCCAAAGATACCCAAGGCTCCCAAGGCTATGCAGAGCCAGCAAGCGGCGAATGTAATGCCCAACCTA
AATGACATGGGCAACCTGAACAGCATGGGAATGGACAACATGATGTTTGGCGGCTGCATGGGTATGATGCCCCCC
AACATGATGGGTATGCAGCAAAACATGGGCATGAACATGGGCATGAATATGGGCATGATGGGAATGCCCATGATG
GGAATGCCTGGGTTTGGTGGTATCAATGTCGGAGGATTCGGAGCTCTGCATAGTGCCTGGGGTATTAACGACATG
AATCCCATGAATGGCATGGGCATGCAAAATCAACAAATGAATGGACCCATGAGCAACGGAATGGGACCTGGCTTC
TTTAATGGAAGCGGACTAATGCAAACAAACGGCAATGAAGACGACGCTTACTTTCGGAAACCCGTTAATCCCCAT
CGTCATCAGAATAAGCAACGAAGAGTACGACCAAGTGACTATCGCGAGCTGTAA
Transcript >OphauB2|5404
ATGTCGTCTTCAGTCTTTTTCAAATTTAAATCGCAAAAGGAACCGACGCGTGTCGAGTTTGACGGTACTGGCATA
TCCGTTTTTGAACTGAAGCGCGAAATCATCAGCAAGAGCGGCCTTGGTGACGGTACTGATTTTGATCTTCACATT
TACACTGACGACAATAGCGAGGAGTATGATGATGATACCACCATTGTCCCTCGCTCCACCACCGTCATTGCACGG
CGCCAACCTGCCATCAAGCCCGGTGCTGGGCGTGCTGCGCGGTATGTTTCGGGCAAAATGCCCGCATCAGCAAAG
AATGCCAGTCGCAAGGAGCAGGCATCGCGTGCAAACGCTGCCAAGTCTGGATCAAACGCCATTAACCAAATGAAT
GAAGCAATGACTGAAGAAGAAAAGATGGAGGCCATGTTTGCTGCCCAGAGTGAACAGTGGTCTGCCCAACAGGAA
GAATTATCACATAATGCACCAGCATATAAACCTGGTGCCAAGAGACCGACCAATGTCCCTGACCATGACCCCCCC
AACGGCTACATTTGCTATCGATGTGGCAACAAAGGCCATTGGATTCAGCTCTGCCCCACAAACGATGATCCCGAC
TTTGACAATAGACCTCGGGTTAAGCGCACCACTGGCATTCCGCGCTCATTTCTTCAAAAGATTGACAAGTCGGCA
ATCCTGGCGCAGACGGACGGAGACGAGACTAAGCGCCCCTCTGGAATCATGGTCAACGCGGATGGCGATTTTGTC
ATTGCTGAGCCTGACAAGGCTTCTTGGGAACAGTTTCAAGCAAAAACCAAGTCATCAAACAAGCCAACGGATGCC
CAGGCCACAGAGAACAAGGAGGTACAAGATCGCGGCCTAGAGTGCCCGATTGACAAGAAAATGTTGATAGAGCCA
ATGAAGACACCCTGCTGCAACAAGACGTTTTGTAATGATTGCATAACAAATGCTCTCATTGAAAGCGATTTTGTC
TGTCCTGCCTGCCAGACTGAAGGTGTCTTGATAGACGATTTGACGCCCGATGAAGATTGCGCAAAAAACATACAA
GAGTACTTAAAGAAGAAGGAGACTTGTGCTGATTCGCCTAGGCCAGTATCAAAATCTGAATCTGACGGCAAGGAA
GGGGAAAACGCCGAGCTCGGCAAAGTAACACAAAACGAGTCTGAATTAAAAGATGACAAGACGACCAAGAAGTCC
AAGTCGCCATCGCCAGGACCAGGCAACAAGTCGCCTGCCCAAGAGCCCAAGAAGTCATGGCCAGGTACTACGACA
GCTCCTGACAAGCCCAGTACGGATGAAGCAAAAGCGATAGAGGTCAAGTCGACTAAACGACCAGCAGAGGATGTG
CTTGAGAACCCAAAGATACCCAAGGCTCCCAAGGCTATGCAGAGCCAGCAAGCGGCGAATGTAATGCCCAACCTA
AATGACATGGGCAACCTGAACAGCATGGGAATGGACAACATGATGTTTGGCGGCTGCATGGGTATGATGCCCCCC
AACATGATGGGTATGCAGCAAAACATGGGCATGAACATGGGCATGAATATGGGCATGATGGGAATGCCCATGATG
GGAATGCCTGGGTTTGGTGGTATCAATGTCGGAGGATTCGGAGCTCTGCATAGTGCCTGGGGTATTAACGACATG
AATCCCATGAATGGCATGGGCATGCAAAATCAACAAATGAATGGACCCATGAGCAACGGAATGGGACCTGGCTTC
TTTAATGGAAGCGGACTAATGCAAACAAACGGCAATGAAGACGACGCTTACTTTCGGAAACCCGTTAATCCCCAT
CGTCATCAGAATAAGCAACGAAGAGTACGACCAAGTGACTATCGCGAGCTGTAA
Gene >OphauB2|5404
ATGTCGTCTTCAGTCTTTTTCAAATTTAAATCGCAAAAGGAACCGACGCGTGTCGAGTTTGACGGTACTGGCATA
TCCGTTTTTGAACTGAAGCGCGAAATCATCAGCAAGAGCGGCCTTGGTGACGGTACTGATTTTGATCTTCACATT
TACACTGACGACAATAGCGAGGGTAAGTACAAAACCATGAATGCCTGTTGCTGTTTTTACTCATGATTGACGGCC
CCTTGTATAGAGTATGATGATGATACCACCATTGTCCCTCGCTCCACCACCGTCATTGCACGGCGCCAACCTGCC
ATCAAGCCCGGTGCTGGGCGTGCTGCGCGGTATGTTTCGGGCAAAATGCCCGCATCAGCAAAGAATGCCAGTCGC
AAGGAGCAGGCATCGCGTGCAAACGCTGCCAAGTCTGGATCAAACGCCATTAACCAAATGAATGAAGCAATGACT
GAAGAAGAAAAGATGGAGGCCATGTTTGCTGCCCAGAGTGAACAGTGGTCTGCCCAACAGGAAGAATTATCACAG
TAGGTTGCCATGACTGAAAGCCATGACTTCACTTTGGCTGACTGACCATGCTGTAATAGTAATGCACCAGCATAT
AAACCTGGTGCCAAGAGACCGACCAATGTCCCTGACCATGACCCCCCCAACGGCTACATTTGCTATCGATGTGGC
AACAAAGGCCATTGGATTCAGCTCTGCCCCACAAACGATGATCCCGACTTTGACAATAGACCTCGGGTTAAGCGC
ACCACTGGCATTCCGCGCTCATTTCTTCAAAAGATTGACAAGTCGGCAATCCTGGCGCAGACGGACGGAGACGAG
ACTAAGCGCCCCTCTGGAATCATGGTCAACGCGGATGGCGATTTTGTCATTGCTGAGCCTGACAAGGCTTCTTGG
GAACAGTTTCAAGCAAAAACCAAGTCATCAAACAAGCCAACGGATGCCCAGGCCACAGAGAACAAGGAGGTACAA
GATCGCGGCCTAGAGTGCCCGATTGACAAGAAAATGTTGATAGAGCCAATGAAGACACCCTGCTGCAACAAGACG
TTTTGTAATGATTGCATAACAAATGCTCTCATTGAAAGCGATTTTGTCTGTCCTGCCTGCCAGACTGAAGGTGTC
TTGATAGACGATTTGACGCCCGATGAAGATTGCGCAAAAAACATACAAGAGTACTTAAAGAAGAAGGAGACTTGT
GCTGATTCGCCTAGGCCAGTATCAAAATCTGAATCTGACGGCAAGGAAGGGGAAAACGCCGAGCTCGGCAAAGTA
ACACAAAACGAGTCTGAATTAAAAGATGACAAGACGACCAAGAAGTCCAAGTCGCCATCGCCAGGACCAGGCAAC
AAGTCGCCTGCCCAAGAGCCCAAGAAGTCATGGCCAGGTACTACGACAGCTCCTGACAAGCCCAGTACGGATGAA
GCAAAAGCGATAGAGGTCAAGTCGACTAAACGACCAGCAGAGGATGTGCTTGAGAACCCAAAGATACCCAAGGCT
CCCAAGGCTATGCAGAGCCAGCAAGCGGCGAATGTAATGCCCAACCTAAATGACATGGGCAACCTGAACAGCATG
GGAATGGACAACATGATGTTTGGCGGCTGCATGGGTATGATGCCCCCCAACATGATGGGTATGCAGCAAAACATG
GGCATGAACATGGGCATGAATATGGGCATGATGGGAATGCCCATGATGGGAATGCCTGGGTTTGGTGGTATCAAT
GTCGGAGGATTCGGAGCTCTGCATAGTGCCTGGGGTATTAACGACATGAATCCCATGAATGGCATGGGCATGCAA
AATCAACAAATGAATGGACCCATGAGCAACGGAATGGGACCTGGCTTCTTTAATGGAAGCGGACTAATGCAAACA
AACGGCAATGAAGACGACGCTTACTTTCGGAAACCCGTTAATCCCCATCGTCATCAGAATAAGCAACGAAGAGTA
CGACCAAGTGACTATCGCGAGCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail