Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5403
Gene name
LocationContig_41:39237..40726
Strand-
Gene length (bp)1489
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 3.0E-32 94 467
PF07687 M20_dimer Peptidase dimerisation domain 9.0E-11 209 366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 1 471 0.0E+00
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 5 469 0.0E+00
sp|P43616|DUG1_YEAST Cys-Gly metallodipeptidase DUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG1 PE=1 SV=1 1 476 0.0E+00
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 5 472 2.0E-180
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 5 472 2.0E-179
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 1 471 0.0E+00
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 5 469 0.0E+00
sp|P43616|DUG1_YEAST Cys-Gly metallodipeptidase DUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG1 PE=1 SV=1 1 476 0.0E+00
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 5 472 2.0E-180
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 5 472 2.0E-179
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 5 472 2.0E-179
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 5 472 5.0E-179
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 5 472 4.0E-177
sp|Q66HG3|CNDP1_RAT Beta-Ala-His dipeptidase OS=Rattus norvegicus GN=Cndp1 PE=1 SV=1 5 467 3.0E-134
sp|Q96KN2|CNDP1_HUMAN Beta-Ala-His dipeptidase OS=Homo sapiens GN=CNDP1 PE=1 SV=4 5 472 9.0E-134
sp|Q8BUG2|CNDP1_MOUSE Beta-Ala-His dipeptidase OS=Mus musculus GN=Cndp1 PE=2 SV=1 5 467 2.0E-133
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 78 464 7.0E-55
sp|P45494|PEPV_LACDL Beta-Ala-Xaa dipeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pepV PE=1 SV=1 95 138 5.0E-07
sp|Q9K9G9|FAPD_BACHD N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine deformylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ylmB PE=1 SV=1 5 191 5.0E-07
sp|O31724|FAPD_BACSU N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine deformylase OS=Bacillus subtilis (strain 168) GN=ylmB PE=1 SV=2 1 250 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5403
MAPQLDGYFKQVDASADDFVARLRKAVAIPSISAEDARRPDVVRMGKWLADELKGLGADVELRQLGKQPHKEHLD
LPPVILARYGNDKKKRTILVYGHYDVQPAEKSDGWATEPFEMTVDGKGRMFGRGSTDDKGPVLGWLNAIDAHKKA
KVEFPVNLLMCFEGMEEYGSEGLDDLIYKEAKGYFADADAVCISDNYWLGTQRPCLTYGLRGCNYYSLEVWGPGA
DLHSGVFGGTVQEPMTDLVRILGSLVDTNGKIQIPGIMEQVALVTQDEDGLYDGISFTMDDLYESLGSKTSIYED
KKATLMARWRYPSLSIHGVEGSFSSPGAKTVIPAKVIGKFSIRTVPDMETDKTNECVYKYVKEQFAKLKSKNTIK
VYAQHTGNWWAASPKHWNFAAAAKATQRVWGVEPDFTREGGSIPVTLTFEQATGKNVLLLPMGSSTDGAHSINEK
LDKRNYIEGIKLLGAYLHYVAEEPQT*
Coding >OphauB2|5403
ATGGCTCCTCAGCTCGACGGATACTTCAAGCAGGTAGACGCCTCGGCCGATGACTTTGTCGCCCGCTTGCGCAAG
GCCGTGGCTATCCCCTCCATCTCGGCCGAGGATGCACGCCGCCCGGATGTCGTGCGCATGGGCAAGTGGCTTGCA
GATGAGCTGAAGGGATTGGGTGCAGATGTAGAGCTACGGCAGCTGGGCAAGCAGCCGCACAAGGAGCATCTTGAC
CTTCCGCCAGTGATACTGGCCCGCTATGGCAATGATAAGAAGAAGCGCACTATTCTTGTCTATGGCCATTACGAT
GTGCAGCCGGCGGAAAAGAGCGATGGCTGGGCAACGGAACCTTTTGAAATGACTGTTGATGGCAAGGGACGCATG
TTTGGCCGCGGCTCAACTGACGACAAGGGACCTGTCCTCGGCTGGCTCAACGCCATTGACGCGCACAAGAAGGCC
AAGGTGGAGTTTCCCGTCAATCTTCTCATGTGCTTTGAGGGAATGGAGGAGTATGGGTCTGAGGGCCTTGACGAC
CTCATTTACAAGGAAGCCAAGGGTTACTTTGCAGATGCCGATGCCGTCTGCATCTCAGACAACTATTGGCTCGGT
ACTCAGAGGCCGTGTCTGACGTATGGACTCCGCGGCTGCAATTATTACTCGCTCGAGGTTTGGGGTCCTGGTGCC
GACCTGCACAGCGGCGTTTTTGGCGGCACTGTTCAAGAGCCCATGACGGATTTGGTGCGCATTTTGGGGTCACTT
GTTGACACCAATGGCAAGATTCAGATTCCTGGCATCATGGAACAAGTTGCCCTTGTTACTCAAGATGAGGACGGG
CTCTACGACGGCATTTCCTTTACCATGGATGATCTCTATGAGTCTCTTGGAAGCAAGACGAGCATTTACGAGGAC
AAGAAGGCGACTCTCATGGCACGGTGGCGCTACCCTTCCCTCTCGATTCACGGCGTCGAGGGCTCCTTTTCTAGC
CCAGGTGCCAAAACCGTTATCCCCGCCAAGGTGATTGGCAAATTCTCAATTCGCACCGTGCCGGACATGGAAACC
GACAAGACCAATGAATGTGTATACAAATATGTCAAGGAGCAGTTTGCCAAACTCAAGAGCAAAAACACAATAAAG
GTTTATGCTCAGCACACTGGCAACTGGTGGGCGGCATCACCCAAACACTGGAACTTTGCTGCTGCAGCCAAGGCG
ACGCAGCGTGTCTGGGGCGTTGAGCCCGACTTTACTCGCGAGGGCGGAAGTATTCCCGTGACTTTGACGTTTGAA
CAGGCAACGGGCAAGAATGTCTTGCTGCTGCCCATGGGAAGCTCGACTGACGGCGCGCACTCAATCAATGAAAAG
TTGGACAAGCGCAACTACATTGAAGGAATTAAGCTGCTTGGCGCCTATCTACACTATGTCGCCGAGGAGCCGCAG
ACATGA
Transcript >OphauB2|5403
ATGGCTCCTCAGCTCGACGGATACTTCAAGCAGGTAGACGCCTCGGCCGATGACTTTGTCGCCCGCTTGCGCAAG
GCCGTGGCTATCCCCTCCATCTCGGCCGAGGATGCACGCCGCCCGGATGTCGTGCGCATGGGCAAGTGGCTTGCA
GATGAGCTGAAGGGATTGGGTGCAGATGTAGAGCTACGGCAGCTGGGCAAGCAGCCGCACAAGGAGCATCTTGAC
CTTCCGCCAGTGATACTGGCCCGCTATGGCAATGATAAGAAGAAGCGCACTATTCTTGTCTATGGCCATTACGAT
GTGCAGCCGGCGGAAAAGAGCGATGGCTGGGCAACGGAACCTTTTGAAATGACTGTTGATGGCAAGGGACGCATG
TTTGGCCGCGGCTCAACTGACGACAAGGGACCTGTCCTCGGCTGGCTCAACGCCATTGACGCGCACAAGAAGGCC
AAGGTGGAGTTTCCCGTCAATCTTCTCATGTGCTTTGAGGGAATGGAGGAGTATGGGTCTGAGGGCCTTGACGAC
CTCATTTACAAGGAAGCCAAGGGTTACTTTGCAGATGCCGATGCCGTCTGCATCTCAGACAACTATTGGCTCGGT
ACTCAGAGGCCGTGTCTGACGTATGGACTCCGCGGCTGCAATTATTACTCGCTCGAGGTTTGGGGTCCTGGTGCC
GACCTGCACAGCGGCGTTTTTGGCGGCACTGTTCAAGAGCCCATGACGGATTTGGTGCGCATTTTGGGGTCACTT
GTTGACACCAATGGCAAGATTCAGATTCCTGGCATCATGGAACAAGTTGCCCTTGTTACTCAAGATGAGGACGGG
CTCTACGACGGCATTTCCTTTACCATGGATGATCTCTATGAGTCTCTTGGAAGCAAGACGAGCATTTACGAGGAC
AAGAAGGCGACTCTCATGGCACGGTGGCGCTACCCTTCCCTCTCGATTCACGGCGTCGAGGGCTCCTTTTCTAGC
CCAGGTGCCAAAACCGTTATCCCCGCCAAGGTGATTGGCAAATTCTCAATTCGCACCGTGCCGGACATGGAAACC
GACAAGACCAATGAATGTGTATACAAATATGTCAAGGAGCAGTTTGCCAAACTCAAGAGCAAAAACACAATAAAG
GTTTATGCTCAGCACACTGGCAACTGGTGGGCGGCATCACCCAAACACTGGAACTTTGCTGCTGCAGCCAAGGCG
ACGCAGCGTGTCTGGGGCGTTGAGCCCGACTTTACTCGCGAGGGCGGAAGTATTCCCGTGACTTTGACGTTTGAA
CAGGCAACGGGCAAGAATGTCTTGCTGCTGCCCATGGGAAGCTCGACTGACGGCGCGCACTCAATCAATGAAAAG
TTGGACAAGCGCAACTACATTGAAGGAATTAAGCTGCTTGGCGCCTATCTACACTATGTCGCCGAGGAGCCGCAG
ACATGA
Gene >OphauB2|5403
ATGGCTCCTCAGCTCGACGGATACTTCAAGCAGGTAGACGCCTCGGCCGATGACTTTGTCGCCCGCTTGCGCAAG
GCCGTGGCTATCCCCTCCATCTCGGCCGAGGATGCACGCCGCCCGGATGTCGTGCGCATGGGCAAGTGGCTTGCA
GATGAGCTGAAGGGATTGGGTGCAGATGTAGAGCTACGGCAGCTGGGCAAGCAGCCGCACAAGGAGCATCTTGAC
CTTCCGCCAGTGATACTGGCCCGCTATGGCAATGATAAGAAGAAGCGCACTATTCTTGTCTATGGCCATTACGAT
GTGCAGCCGGCGGAAAAGAGCGATGGCTGGGCAACGGAACCTTTTGAAATGACTGTTGATGGCAAGGGACGCATG
TTTGGCCGCGGCTCAACTGACGACAAGGGACCTGTCCTCGGCTGGCTCAACGCCATTGACGCGCACAAGAAGGCC
AAGGTGGAGTTTCCCGTCAATCTTCTCATGTGCTTTGAGGGAATGGAGGAGTATGGGTCTGAGGGCCTTGACGAC
CTCATTTACAAGGAAGCCAAGGGTTACTTTGCAGATGCCGATGCCGTCTGCATCTCAGACAACTATTGGCTCGGT
ACTCAGAGGCCGTGTCTGACGTATGGACTCCGCGGCTGCAATTATTACTCGCTCGAGGTTTGGGGTCCTGGTGCC
GACCTGCACAGCGGCGTTTTTGGCGGCACTGTTCAAGAGCCCATGACGGATTTGGTGCGCATTTTGGGGTCACTT
GTTGACACCAATGGCAAGATTCAGATTCCTGGCATCATGGAACAAGTTGCCCTTGTTACTCAAGATGAGGACGGG
CTCTACGACGGCATTTCCTTTACCATGGATGATCTCTATGAGTCTCTTGGAAGCAAGACGAGCATTTACGAGGAC
AAGAAGGCGACTCTCATGGCACGGTGGCGCTACCCTTCCCTCTCGATTCACGGCGTCGAGGGCTCCTTTTCTAGC
CCAGGTGCCAAAACCGTTATCCCCGCCAAGGTGATTGGCAAATTCTCAATTCGCACCGTGCCGGACATGGAAACC
GACAAGACCAATGAATGTGTATACAAATATGTCAAGGAGCAGTTTGCCAAACTCAAGAGCAAAAACACAATAAAG
GTTTATGCTCAGCACACTGGCAACTGGTGGGCGGCATCACCCAAACACTGGAACTTTGCTGCTGCAGCCAAGGCG
ACGCAGCGTGTCTGGGGCGTTGAGCCCGACTTTACTCGCGAGGGCGGAAGGTGAGCAGAGCAGCCTGTCGGGTAG
CGGCATGTGCTTTTTTACTGATGGCGCGTCTAGTATTCCCGTGACTTTGACGTTTGAACAGGCAACGGGCAAGAA
TGTCTTGCTGCTGCCCATGGGAAGCTCGACTGACGGCGCGCACTCAATCAATGAAAAGTTGGACAAGCGCAACTA
CATTGAAGGAATTAAGCTGCTTGGCGCCTATCTACACTATGTCGCCGAGGAGCCGCAGACATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail