Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5395
Gene name
LocationContig_41:24052..27428
Strand+
Gene length (bp)3376
Transcript length (bp)3108
Coding sequence length (bp)3108
Protein length (aa) 1036

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain 1.0E-55 6 165
PF08644 SPT16 FACT complex subunit (SPT16/CDC68) 1.3E-55 547 697
PF00557 Peptidase_M24 Metallopeptidase family M24 1.9E-26 183 422
PF08512 Rtt106 Histone chaperone Rttp106-like 2.8E-17 824 910

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0X6|SPT16_NEUCR FACT complex subunit ctc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ctc-2 PE=3 SV=1 1 1035 0.0E+00
sp|O82491|SPT16_ARATH FACT complex subunit SPT16 OS=Arabidopsis thaliana GN=SPT16 PE=1 SV=1 6 1035 0.0E+00
sp|Q9W603|SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis GN=supt16h PE=1 SV=2 4 1034 0.0E+00
sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 4 1016 0.0E+00
sp|Q920B9|SP16H_MOUSE FACT complex subunit SPT16 OS=Mus musculus GN=Supt16h PE=1 SV=2 4 1016 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0X6|SPT16_NEUCR FACT complex subunit ctc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ctc-2 PE=3 SV=1 1 1035 0.0E+00
sp|O82491|SPT16_ARATH FACT complex subunit SPT16 OS=Arabidopsis thaliana GN=SPT16 PE=1 SV=1 6 1035 0.0E+00
sp|Q9W603|SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis GN=supt16h PE=1 SV=2 4 1034 0.0E+00
sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 4 1016 0.0E+00
sp|Q920B9|SP16H_MOUSE FACT complex subunit SPT16 OS=Mus musculus GN=Supt16h PE=1 SV=2 4 1016 0.0E+00
sp|Q8IRG6|SPT16_DROME FACT complex subunit spt16 OS=Drosophila melanogaster GN=dre4 PE=1 SV=2 1 1030 0.0E+00
sp|Q6FWT4|SPT16_CANGA FACT complex subunit SPT16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT16 PE=3 SV=1 1 941 0.0E+00
sp|Q00976|SPT16_KLULA FACT complex subunit SPT16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT16 PE=3 SV=2 1 941 0.0E+00
sp|P32558|SPT16_YEAST FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT16 PE=1 SV=1 1 1023 0.0E+00
sp|P0CQ22|SPT16_CRYNJ FACT complex subunit SPT16 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT16 PE=3 SV=1 1 1016 0.0E+00
sp|Q5A1D5|SPT16_CANAL FACT complex subunit SPT16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT16 PE=3 SV=1 1 941 0.0E+00
sp|P0CQ23|SPT16_CRYNB FACT complex subunit SPT16 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT16 PE=3 SV=1 1 1016 0.0E+00
sp|Q756A7|SPT16_ASHGO FACT complex subunit SPT16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT16 PE=3 SV=2 1 1017 0.0E+00
sp|Q6BXE5|SPT16_DEBHA FACT complex subunit SPT16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT16 PE=3 SV=2 1 1017 0.0E+00
sp|Q6C931|SPT16_YARLI FACT complex subunit SPT16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPT16 PE=3 SV=1 3 1018 0.0E+00
sp|Q4P2U5|SPT16_USTMA FACT complex subunit SPT16 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT16 PE=3 SV=1 4 1034 0.0E+00
sp|O94267|SPT16_SCHPO FACT complex subunit spt16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt16 PE=1 SV=1 1 1034 0.0E+00
sp|Q4WJ02|SPT16_ASPFU FACT complex subunit spt16 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt16 PE=3 SV=1 3 1033 0.0E+00
sp|Q5B2X8|SPT16_EMENI FACT complex subunit spt16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt16 PE=3 SV=2 3 1033 0.0E+00
sp|Q2UBF1|SPT16_ASPOR FACT complex subunit spt16 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt16 PE=3 SV=1 3 1033 0.0E+00
sp|Q4HYB8|SPT16_GIBZE FACT complex subunit SPT16 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT16 PE=3 SV=1 1 1035 0.0E+00
sp|Q7X923|SPT16_ORYSJ FACT complex subunit SPT16 OS=Oryza sativa subsp. japonica GN=SPT16 PE=2 SV=2 11 1033 1.0E-177
sp|Q8H6B1|SPT16_MAIZE FACT complex subunit SPT16 OS=Zea mays GN=SPT16 PE=2 SV=1 11 1035 6.0E-174
sp|Q61E63|SPT16_CAEBR FACT complex subunit spt-16 OS=Caenorhabditis briggsae GN=spt-16 PE=3 SV=1 4 1017 1.0E-167
sp|Q54S43|SPT16_DICDI FACT complex subunit SPT16 OS=Dictyostelium discoideum GN=spt16 PE=3 SV=1 6 956 4.0E-167
sp|Q9N5R9|SPT16_CAEEL FACT complex subunit spt-16 OS=Caenorhabditis elegans GN=spt-16 PE=3 SV=1 6 1031 5.0E-162
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5395
MSDIKIDSKLFQERISHFATAWKNDLRSKDSVFGGVSSIVIMMGKVEEIPEYHKNNAMHFWLLGYEFPTTLMLFT
VDTLFIVTTQKKAKHLDQLKGGRFPIEVLVRGKDAAENEKLFVSICDKIKAAGDKVGTLAKDTSKGPFVDEWKKI
FAEKCKDVQDVDVSAALSTFALSVKDESELRAMRTASKACVALMTPYFLDEMSNILDSEKKVTHMTLGERVDKKL
DDNKFWKTVQLPSKGKLPADFDLAQLDWILGPAIQSGGKYDLRFVAEPNNDNLHAGIIIAALGLRYKSYCSTIAR
TYLVDPNKSQESNYKLLYMIHNTIIKEIRDGMAVKDVYAKALGIVKSKKPEMEKHFLKNVGWGIGLENRDPTLII
NAKNTRTLKDGMTLVIHTGFQDIENPQPQDKSSKVYSLVLTDTIRVTTSEPVVFTAEAPTSADANSFFFKDDEEV
EPPPKKEKKDSRVGAVATKNITNTRLRSERATQVDDDADKKRREHQKELAIKNQKEGLARFAESTSGQNGSEVKK
FKRFESYKREDQFPPKIKNLEIVVDAKNNTVVLPIMGRPVPFHINTIKNASKSDEGDFSFLRINFLSPGQGVGRK
DDQPFEDASAHFVRSLTFRSADGGRYSEIATQISNMKRDVVKREQEKKDMEDVVEQDKLMEIRNRRPAVLDNVYI
RPAMEGKRVPGKVEIHQNGIRYQSPLNAQHRVDVLFSNVRHLFFQPCQHELIVIIHIHLKDPIIVGNKKKTKDVQ
FYREATDIQFDETGNRKRKYRYGDEDEFEAEQEERRRRTELDRLFQGFAQKIAEAGRSEGIEVDMPLRDLGFYGV
PFRSNVFIQPTTDCLIQVVEPPFMVLTIEDIEVAHLERVQFGLKNFDMVFVFKDFTRAPYHINTIPVEYLDQVKD
FLDSSDIAFTEGPLNFNWAAIMKTVTADTHQFFVDGGWQFLQPESDESGGEGGADDEESAFELDDEELDEASQSS
EEDSDFGSNVSDEDDDGDAELDSDDEGEDWDELEKKARKRDREAAHEDDEDRGAKKKRKR*
Coding >OphauB2|5395
ATGTCGGACATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATTTCGCACTTTGCGACCGCCTGGAAGAATGAC
TTGCGCTCCAAGGACAGTGTCTTCGGCGGCGTCTCGTCCATTGTCATCATGATGGGCAAAGTGGAGGAAATCCCC
GAGTACCACAAGAATAACGCCATGCACTTTTGGCTCCTTGGCTACGAATTTCCGACGACGCTCATGCTCTTTACT
GTCGACACGCTCTTCATCGTGACGACGCAGAAGAAAGCAAAACATCTCGATCAGCTCAAGGGCGGTCGCTTTCCT
ATAGAAGTCCTAGTTCGAGGCAAGGACGCCGCAGAGAACGAAAAGCTATTTGTCAGCATCTGTGACAAGATAAAA
GCTGCAGGGGACAAGGTTGGCACCCTGGCTAAGGACACGTCCAAAGGCCCTTTTGTCGACGAGTGGAAAAAGATT
TTTGCAGAAAAGTGCAAAGATGTGCAAGACGTCGACGTCTCGGCTGCATTGTCCACCTTTGCCCTCTCTGTCAAG
GATGAGAGCGAACTGCGCGCTATGCGAACTGCCTCCAAGGCTTGCGTGGCCCTCATGACGCCCTACTTCCTCGAC
GAAATGTCCAACATTCTCGACTCGGAGAAGAAGGTGACTCATATGACACTGGGCGAAAGAGTCGACAAGAAGCTC
GACGACAACAAATTTTGGAAGACTGTACAGTTGCCGAGCAAGGGCAAACTTCCAGCCGACTTTGATCTAGCACAG
CTCGACTGGATACTTGGCCCAGCTATCCAGAGCGGAGGCAAATACGATCTTCGGTTTGTTGCAGAGCCCAACAAC
GATAACTTGCACGCCGGAATCATCATTGCAGCATTGGGTCTCCGTTACAAGTCGTACTGCTCCACCATTGCTCGT
ACTTACCTTGTCGACCCCAACAAGTCGCAGGAGAGCAACTACAAGCTCTTGTACATGATTCACAATACCATTATT
AAGGAGATTCGGGACGGAATGGCAGTCAAGGACGTTTACGCCAAGGCTCTTGGTATCGTCAAGAGCAAGAAACCC
GAAATGGAGAAGCATTTTCTCAAAAATGTTGGCTGGGGCATTGGCCTGGAGAATCGGGATCCCACATTGATCATC
AATGCTAAGAACACGAGGACGCTCAAGGACGGCATGACGCTTGTCATTCATACCGGTTTCCAAGACATTGAGAAC
CCACAACCCCAGGATAAGAGCAGCAAAGTCTACTCGCTTGTTCTCACTGATACGATTCGTGTGACGACGAGCGAG
CCAGTTGTCTTTACTGCCGAGGCACCGACGAGTGCAGACGCAAACTCCTTTTTTTTCAAGGATGACGAAGAGGTG
GAGCCGCCTCCAAAAAAAGAGAAGAAGGACTCGAGAGTCGGTGCTGTGGCTACTAAGAACATCACAAACACCAGA
CTTCGGTCTGAGCGTGCAACTCAAGTTGACGACGATGCGGATAAGAAGCGCAGAGAACATCAAAAGGAGCTTGCA
ATCAAGAATCAAAAAGAAGGCCTGGCTAGATTTGCAGAATCTACAAGCGGGCAAAATGGGTCCGAGGTGAAGAAA
TTTAAGCGCTTCGAGTCGTATAAACGCGAAGATCAATTCCCCCCCAAGATTAAAAACCTCGAGATTGTTGTCGAT
GCCAAGAACAACACGGTCGTGTTGCCCATCATGGGGCGACCAGTTCCATTTCACATCAATACCATCAAAAATGCC
AGCAAGAGTGACGAAGGCGATTTCTCCTTTTTGCGCATCAACTTTCTCTCTCCAGGCCAGGGTGTCGGTCGCAAA
GACGACCAGCCGTTTGAGGATGCATCGGCTCACTTTGTGCGCAGCTTGACTTTCCGGTCGGCGGATGGCGGCAGA
TATAGCGAGATTGCTACGCAAATATCCAATATGAAGCGCGACGTGGTCAAGAGGGAACAGGAAAAGAAGGACATG
GAGGATGTGGTTGAGCAAGACAAGCTAATGGAGATTAGAAATCGCCGTCCTGCAGTCTTGGACAATGTTTACATT
CGACCGGCCATGGAGGGGAAGCGGGTGCCTGGAAAAGTCGAGATACACCAAAATGGTATTAGATACCAGTCGCCA
TTGAATGCACAGCACCGTGTCGATGTCCTCTTTTCCAACGTCCGACACTTGTTTTTCCAGCCCTGCCAGCACGAA
TTGATTGTCATTATTCACATACACCTCAAAGACCCCATTATTGTGGGCAACAAAAAAAAGACCAAGGACGTACAA
TTCTATCGCGAGGCTACCGACATACAGTTTGACGAGACTGGCAACCGCAAGCGCAAGTACCGGTACGGCGACGAG
GATGAATTCGAGGCCGAGCAAGAGGAGCGGCGCCGCAGGACCGAGCTGGACCGACTATTCCAAGGTTTTGCGCAA
AAAATTGCTGAGGCTGGTCGCAGCGAGGGCATCGAGGTTGACATGCCGCTGCGCGACCTTGGTTTTTACGGCGTG
CCTTTTCGCAGCAACGTCTTTATCCAGCCAACGACGGATTGCCTGATTCAGGTTGTCGAGCCGCCATTCATGGTT
CTCACCATTGAAGACATTGAAGTGGCTCACCTGGAGCGTGTGCAGTTTGGGCTCAAAAACTTTGACATGGTGTTT
GTCTTTAAGGACTTTACACGCGCGCCCTACCACATCAATACGATTCCTGTAGAGTATCTTGACCAGGTAAAGGAC
TTTCTCGACTCGTCGGACATTGCCTTTACCGAAGGCCCCCTCAACTTCAACTGGGCTGCCATTATGAAGACTGTC
ACGGCCGACACGCACCAATTCTTTGTCGATGGCGGCTGGCAGTTTCTGCAGCCCGAGTCTGACGAGTCGGGCGGC
GAGGGCGGCGCCGACGATGAGGAGTCGGCATTTGAGCTTGACGACGAGGAACTCGACGAGGCGAGCCAATCGTCG
GAAGAAGACTCTGATTTTGGGAGCAATGTTAGTGACGAGGATGATGATGGCGATGCTGAGCTGGATAGCGACGAC
GAGGGCGAAGACTGGGACGAATTGGAAAAGAAGGCGCGCAAGCGCGATCGTGAGGCTGCACATGAAGACGACGAA
GACCGCGGCGCCAAAAAGAAGCGTAAGCGCTGA
Transcript >OphauB2|5395
ATGTCGGACATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATTTCGCACTTTGCGACCGCCTGGAAGAATGAC
TTGCGCTCCAAGGACAGTGTCTTCGGCGGCGTCTCGTCCATTGTCATCATGATGGGCAAAGTGGAGGAAATCCCC
GAGTACCACAAGAATAACGCCATGCACTTTTGGCTCCTTGGCTACGAATTTCCGACGACGCTCATGCTCTTTACT
GTCGACACGCTCTTCATCGTGACGACGCAGAAGAAAGCAAAACATCTCGATCAGCTCAAGGGCGGTCGCTTTCCT
ATAGAAGTCCTAGTTCGAGGCAAGGACGCCGCAGAGAACGAAAAGCTATTTGTCAGCATCTGTGACAAGATAAAA
GCTGCAGGGGACAAGGTTGGCACCCTGGCTAAGGACACGTCCAAAGGCCCTTTTGTCGACGAGTGGAAAAAGATT
TTTGCAGAAAAGTGCAAAGATGTGCAAGACGTCGACGTCTCGGCTGCATTGTCCACCTTTGCCCTCTCTGTCAAG
GATGAGAGCGAACTGCGCGCTATGCGAACTGCCTCCAAGGCTTGCGTGGCCCTCATGACGCCCTACTTCCTCGAC
GAAATGTCCAACATTCTCGACTCGGAGAAGAAGGTGACTCATATGACACTGGGCGAAAGAGTCGACAAGAAGCTC
GACGACAACAAATTTTGGAAGACTGTACAGTTGCCGAGCAAGGGCAAACTTCCAGCCGACTTTGATCTAGCACAG
CTCGACTGGATACTTGGCCCAGCTATCCAGAGCGGAGGCAAATACGATCTTCGGTTTGTTGCAGAGCCCAACAAC
GATAACTTGCACGCCGGAATCATCATTGCAGCATTGGGTCTCCGTTACAAGTCGTACTGCTCCACCATTGCTCGT
ACTTACCTTGTCGACCCCAACAAGTCGCAGGAGAGCAACTACAAGCTCTTGTACATGATTCACAATACCATTATT
AAGGAGATTCGGGACGGAATGGCAGTCAAGGACGTTTACGCCAAGGCTCTTGGTATCGTCAAGAGCAAGAAACCC
GAAATGGAGAAGCATTTTCTCAAAAATGTTGGCTGGGGCATTGGCCTGGAGAATCGGGATCCCACATTGATCATC
AATGCTAAGAACACGAGGACGCTCAAGGACGGCATGACGCTTGTCATTCATACCGGTTTCCAAGACATTGAGAAC
CCACAACCCCAGGATAAGAGCAGCAAAGTCTACTCGCTTGTTCTCACTGATACGATTCGTGTGACGACGAGCGAG
CCAGTTGTCTTTACTGCCGAGGCACCGACGAGTGCAGACGCAAACTCCTTTTTTTTCAAGGATGACGAAGAGGTG
GAGCCGCCTCCAAAAAAAGAGAAGAAGGACTCGAGAGTCGGTGCTGTGGCTACTAAGAACATCACAAACACCAGA
CTTCGGTCTGAGCGTGCAACTCAAGTTGACGACGATGCGGATAAGAAGCGCAGAGAACATCAAAAGGAGCTTGCA
ATCAAGAATCAAAAAGAAGGCCTGGCTAGATTTGCAGAATCTACAAGCGGGCAAAATGGGTCCGAGGTGAAGAAA
TTTAAGCGCTTCGAGTCGTATAAACGCGAAGATCAATTCCCCCCCAAGATTAAAAACCTCGAGATTGTTGTCGAT
GCCAAGAACAACACGGTCGTGTTGCCCATCATGGGGCGACCAGTTCCATTTCACATCAATACCATCAAAAATGCC
AGCAAGAGTGACGAAGGCGATTTCTCCTTTTTGCGCATCAACTTTCTCTCTCCAGGCCAGGGTGTCGGTCGCAAA
GACGACCAGCCGTTTGAGGATGCATCGGCTCACTTTGTGCGCAGCTTGACTTTCCGGTCGGCGGATGGCGGCAGA
TATAGCGAGATTGCTACGCAAATATCCAATATGAAGCGCGACGTGGTCAAGAGGGAACAGGAAAAGAAGGACATG
GAGGATGTGGTTGAGCAAGACAAGCTAATGGAGATTAGAAATCGCCGTCCTGCAGTCTTGGACAATGTTTACATT
CGACCGGCCATGGAGGGGAAGCGGGTGCCTGGAAAAGTCGAGATACACCAAAATGGTATTAGATACCAGTCGCCA
TTGAATGCACAGCACCGTGTCGATGTCCTCTTTTCCAACGTCCGACACTTGTTTTTCCAGCCCTGCCAGCACGAA
TTGATTGTCATTATTCACATACACCTCAAAGACCCCATTATTGTGGGCAACAAAAAAAAGACCAAGGACGTACAA
TTCTATCGCGAGGCTACCGACATACAGTTTGACGAGACTGGCAACCGCAAGCGCAAGTACCGGTACGGCGACGAG
GATGAATTCGAGGCCGAGCAAGAGGAGCGGCGCCGCAGGACCGAGCTGGACCGACTATTCCAAGGTTTTGCGCAA
AAAATTGCTGAGGCTGGTCGCAGCGAGGGCATCGAGGTTGACATGCCGCTGCGCGACCTTGGTTTTTACGGCGTG
CCTTTTCGCAGCAACGTCTTTATCCAGCCAACGACGGATTGCCTGATTCAGGTTGTCGAGCCGCCATTCATGGTT
CTCACCATTGAAGACATTGAAGTGGCTCACCTGGAGCGTGTGCAGTTTGGGCTCAAAAACTTTGACATGGTGTTT
GTCTTTAAGGACTTTACACGCGCGCCCTACCACATCAATACGATTCCTGTAGAGTATCTTGACCAGGTAAAGGAC
TTTCTCGACTCGTCGGACATTGCCTTTACCGAAGGCCCCCTCAACTTCAACTGGGCTGCCATTATGAAGACTGTC
ACGGCCGACACGCACCAATTCTTTGTCGATGGCGGCTGGCAGTTTCTGCAGCCCGAGTCTGACGAGTCGGGCGGC
GAGGGCGGCGCCGACGATGAGGAGTCGGCATTTGAGCTTGACGACGAGGAACTCGACGAGGCGAGCCAATCGTCG
GAAGAAGACTCTGATTTTGGGAGCAATGTTAGTGACGAGGATGATGATGGCGATGCTGAGCTGGATAGCGACGAC
GAGGGCGAAGACTGGGACGAATTGGAAAAGAAGGCGCGCAAGCGCGATCGTGAGGCTGCACATGAAGACGACGAA
GACCGCGGCGCCAAAAAGAAGCGTAAGCGCTGA
Gene >OphauB2|5395
ATGTCGGACATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATTTCGCACTTTGCGACCGCCTGGAAGAATGAC
TTGCGCTCCAAGGACAGTGTCTTCGGCGGCGTCTCGTCCATTGTCATCATGATGGGCAAAGTGGAGGAAATCCCC
GAGTACCACAAGAATAACGCCATGCACGTGAGTGGAGGGCCTGGATCCCTGCCTCAATTGCCGTGCCGATGTAGT
GCTGACGGTTGGCTGCTAGTTTTGGCTCCTTGGCTACGAATTTCCGACGACGCTCATGCTCTTTACTGTCGACAC
GCTCTTCATCGTGACGACGCAGAAGAAAGGTATTCATTTCAGGACCGAGACGCTGGCCAATCTGAGCTGACACCT
TGTCAGCAAAACATCTCGATCAGCTCAAGGGCGGTCGCTTTCCTATAGAAGTCCTAGTTCGAGGCAAGGACGCCG
CAGAGAACGAAAAGCTATTTGTCAGCATCTGTGACAAGATAAAAGCTGCAGGGGTAGGTGCCGTTTCTAGATGCT
TTTCCACAATGATCTGCTGACTAGTCTTTGCCGACAGGACAAGGTTGGCACCCTGGCTAAGGACACGTCCAAAGG
CCCTTTTGTCGACGAGTGGAAAAAGATTTTTGCAGAAAAGTGCAAAGATGTGCAAGACGTCGACGTCTCGGCTGC
ATTGTCCACCTTTGCCCTCTCTGTCAAGGATGAGAGCGAACTGCGCGCTATGCGAACTGCCTCCAAGGCTTGCGT
GGCCCTCATGACGCCCTACTTCCTCGACGAAATGTCCAACATTCTCGACTCGGAGAAGAAGGTGACTCATATGAC
ACTGGGCGAAAGAGTCGACAAGAAGCTCGACGACAACAAATTTTGGAAGACTGTACAGTTGCCGAGCAAGGGCAA
ACTTCCAGCCGACTTTGATCTAGCACAGCTCGACTGGATACTTGGCCCAGCTATCCAGAGCGGAGGCAAATACGA
TCTTCGGTTTGTTGCAGAGCCCAACAACGATAACTTGCACGCCGGAATCATCATTGCAGCATTGGGTCTCCGTTA
CAAGTCGTACTGCTCCACCATTGCTCGTACTTACCTTGTCGACCCCAACAAGTCGCAGGAGAGCAACTACAAGCT
CTTGTACATGATTCACAATACCATTATTAAGGAGATTCGGGACGGAATGGCAGTCAAGGACGTTTACGCCAAGGC
TCTTGGTATCGTCAAGAGCAAGAAACCCGAAATGGAGAAGCATTTTCTCAAAAATGTTGGCTGGGGCATTGGCCT
GGAGAATCGGGATCCCACATTGATCATCAATGCTAAGAACACGAGGACGCTCAAGGACGGCATGACGCTTGTCAT
TCATACCGGTTTCCAAGACATTGAGAACCCACAACCCCAGGATAAGAGCAGCAAAGTCTACTCGCTTGTTCTCAC
TGATACGATTCGTGTGACGACGAGCGAGCCAGTTGTCTTTACTGCCGAGGCACCGACGAGTGCAGACGCAAACTC
CTTTTTTTTCAAGGATGACGAAGAGGTGGAGCCGCCTCCAAAAAAAGAGAAGAAGGACTCGAGAGTCGGTGCTGT
GGCTACTAAGAACATCACAAACACCAGACTTCGGTCTGAGCGTGCAACTCAAGTTGACGACGATGCGGATAAGAA
GCGCAGAGAACATCAAAAGGAGCTTGCAATCAAGAATCAAAAAGAAGGCCTGGCTAGATTTGCAGAATCTACAAG
CGGGCAAAATGGGTCCGAGGTGAAGAAATTTAAGCGCTTCGAGTCGTATAAACGCGAAGATCAATTCCCCCCCAA
GATTAAAAACCTCGAGATTGTTGTCGATGCCAAGAACAACACGGTCGTGTTGCCCATCATGGGGCGACCAGTTCC
ATTTCACATCAATACCATCAAAAATGCCAGCAAGAGTGACGAAGGCGATTTCTCCTTTTTGCGCATCAACTTTCT
CTCTCCAGGCCAGGGTGTCGGTCGCAAAGACGACCAGCCGTTTGAGGATGCATCGGCTCACTTTGTGCGCAGCTT
GACTTTCCGGTCGGCGGATGGCGGCAGATATAGCGAGATTGCTACGCAAATATCCAATATGAAGCGCGACGTGGT
CAAGAGGGAACAGGAAAAGAAGGACATGGAGGATGTGGTTGAGCAAGACAAGCTAATGGAGATTAGAAGTGAGTG
GCTGTTGCGTCTTTTCCTCCCCTTTTTGCCCTTTTGGTGGCCTTGGTGTTGGTCAAGATGACTTACAAGCTCTTC
ATCAACAGATCGCCGTCCTGCAGTCTTGGACAATGTTTACATTCGACCGGCCATGGAGGGGAAGCGGGTGCCTGG
AAAAGTCGAGATACACCAAAATGGTATTAGATACCAGTCGCCATTGAATGCACAGCACCGTGTCGATGTCCTCTT
TTCCAACGTCCGACACTTGTTTTTCCAGCCCTGCCAGCACGAATTGATTGTCATTATTCACATACACCTCAAAGA
CCCCATTATTGTGGGCAACAAAAAAAAGACCAAGGACGTACAATTCTATCGCGAGGCTACCGACATACAGTTTGA
CGAGACTGGCAACCGCAAGCGCAAGTACCGGTACGGCGACGAGGATGAATTCGAGGCCGAGCAAGAGGAGCGGCG
CCGCAGGACCGAGCTGGACCGACTATTCCAAGGTTTTGCGCAAAAAATTGCTGAGGCTGGTCGCAGCGAGGGCAT
CGAGGTTGACATGCCGCTGCGCGACCTTGGTTTTTACGGCGTGCCTTTTCGCAGCAACGTCTTTATCCAGCCAAC
GACGGATTGCCTGATTCAGGTTGTCGAGCCGCCATTCATGGTTCTCACCATTGAAGACATTGAAGTGGCTCACCT
GGAGCGTGTGCAGTTTGGGCTCAAAAACTTTGACATGGTGTTTGTCTTTAAGGACTTTACACGCGCGCCCTACCA
CATCAATACGATTCCTGTAGAGTATCTTGACCAGGTAAAGGACTTTCTCGACTCGTCGGACATTGCCTTTACCGA
AGGCCCCCTCAACTTCAACTGGGCTGCCATTATGAAGACTGTCACGGCCGACACGCACCAATTCTTTGTCGATGG
CGGCTGGCAGTTTCTGCAGCCCGAGTCTGACGAGTCGGGCGGCGAGGGCGGCGCCGACGATGAGGAGTCGGCATT
TGAGCTTGACGACGAGGAACTCGACGAGGCGAGCCAATCGTCGGAAGAAGACTCTGATTTTGGGAGCAATGTTAG
TGACGAGGATGATGATGGCGATGCTGAGCTGGATAGCGACGACGAGGGCGAAGACTGGGACGAATTGGAAAAGAA
GGCGCGCAAGCGCGATCGTGAGGCTGCACATGAAGACGACGAAGACCGCGGCGCCAAAAAGAAGCGTAAGCGCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail