Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5392
Gene name
LocationContig_41:13687..14969
Strand+
Gene length (bp)1282
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01940 DUF92 Integral membrane protein DUF92 8.3E-88 9 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96HH6|TMM19_HUMAN Transmembrane protein 19 OS=Homo sapiens GN=TMEM19 PE=1 SV=1 4 267 4.0E-20
sp|Q5RF73|TMM19_PONAB Transmembrane protein 19 OS=Pongo abelii GN=TMEM19 PE=2 SV=1 4 267 2.0E-19
sp|Q0P4L9|TMM19_XENTR Transmembrane protein 19 OS=Xenopus tropicalis GN=tmem19 PE=2 SV=1 4 267 2.0E-18
sp|Q91W52|TMM19_MOUSE Transmembrane protein 19 OS=Mus musculus GN=Tmem19 PE=1 SV=1 5 267 4.0E-18
sp|Q6IR76|TMM19_XENLA Transmembrane protein 19 OS=Xenopus laevis GN=tmem19 PE=2 SV=1 4 267 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96HH6|TMM19_HUMAN Transmembrane protein 19 OS=Homo sapiens GN=TMEM19 PE=1 SV=1 4 267 4.0E-20
sp|Q5RF73|TMM19_PONAB Transmembrane protein 19 OS=Pongo abelii GN=TMEM19 PE=2 SV=1 4 267 2.0E-19
sp|Q0P4L9|TMM19_XENTR Transmembrane protein 19 OS=Xenopus tropicalis GN=tmem19 PE=2 SV=1 4 267 2.0E-18
sp|Q91W52|TMM19_MOUSE Transmembrane protein 19 OS=Mus musculus GN=Tmem19 PE=1 SV=1 5 267 4.0E-18
sp|Q6IR76|TMM19_XENLA Transmembrane protein 19 OS=Xenopus laevis GN=tmem19 PE=2 SV=1 4 267 2.0E-15
sp|Q6P726|TMM19_RAT Transmembrane protein 19 OS=Rattus norvegicus GN=Tmem19 PE=2 SV=2 18 267 5.0E-14
sp|Q58343|Y933_METJA Uncharacterized membrane protein MJ0933 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0933 PE=3 SV=1 129 256 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 183 205 22
3 231 253 22
4 358 380 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5392
MKAVVSIPATIALVGYAWKKKSLTPLGLVAGALTAVVHAWHPWNLSFVLLLVFFLAGSRATRVKENVKAHLTTHS
RGSSGPEGPRTHVQVLANSLMGSILTLLHALQLRWRAAAYADTGSPNPHGTMCFSWGGDLLVIGIIANYACVTAD
TFSSELGILSRSEPRLITSPTLRKVPRGTNGGVTLLGLAAGILGSLIIVTAAMLALPVCTHETSHSLGGGIPWSL
EQRRVLMIFLVMWGILGSLLDSILGALFQRSVRDIRSGKIVEGEGGCRVLVSASTDAVVGGSVKRAEAMAAALGG
EDGSTAAQKLNACAIDEEHEETEVRIPPEKKHRKSSFGDERPSRVVESGWDLLDNNDVNFLMACMMSVGAMAVAS
WYWAIPLESLMRP*
Coding >OphauB2|5392
ATGAAGGCCGTCGTATCCATTCCCGCAACGATAGCGCTTGTTGGGTACGCCTGGAAGAAAAAATCGCTGACGCCA
CTGGGCCTCGTCGCCGGTGCGCTAACCGCCGTTGTGCACGCCTGGCATCCGTGGAACCTTTCCTTTGTCCTACTC
CTGGTCTTCTTCTTGGCCGGCTCTCGGGCTACCCGTGTCAAGGAAAATGTCAAGGCTCACTTGACAACGCACTCT
CGGGGTAGCTCAGGGCCAGAGGGGCCCCGGACCCATGTTCAAGTCTTGGCAAACTCCCTCATGGGCTCTATTCTC
ACTCTTCTTCACGCTCTTCAACTACGTTGGCGAGCTGCTGCCTATGCCGACACTGGTTCGCCAAACCCGCATGGT
ACAATGTGCTTCTCGTGGGGCGGCGATCTTCTCGTCATCGGCATCATTGCAAATTACGCCTGCGTCACGGCCGAC
ACGTTTAGCTCAGAGCTTGGCATCTTGTCCCGGAGTGAACCACGGCTTATAACGTCTCCGACTCTGCGGAAAGTG
CCGCGGGGTACCAACGGGGGCGTCACCTTACTGGGTCTAGCGGCCGGTATATTGGGCTCTCTGATTATTGTGACA
GCTGCCATGTTAGCGCTGCCCGTCTGCACTCATGAAACGTCCCACTCGTTGGGAGGTGGCATTCCCTGGTCACTG
GAGCAACGAAGGGTTTTGATGATATTCTTGGTGATGTGGGGAATACTGGGGAGTCTCCTAGACAGTATTCTCGGG
GCCTTGTTTCAGCGATCTGTCCGTGACATTCGTTCAGGCAAAATTGTCGAGGGAGAAGGCGGCTGCCGCGTCCTC
GTGTCGGCCAGCACAGATGCCGTGGTTGGGGGTTCTGTCAAACGTGCCGAGGCCATGGCAGCAGCACTTGGCGGA
GAAGATGGCAGCACAGCTGCCCAGAAGCTCAACGCATGTGCTATTGACGAGGAACACGAAGAGACAGAAGTTCGG
ATACCACCAGAGAAGAAGCACCGCAAGTCGAGCTTCGGGGACGAACGGCCCTCACGTGTCGTGGAGAGTGGATGG
GATCTTCTCGACAATAATGATGTGAACTTTCTCATGGCATGTATGATGAGTGTCGGCGCCATGGCCGTGGCCAGT
TGGTACTGGGCTATTCCCTTGGAATCGCTGATGAGACCGTGA
Transcript >OphauB2|5392
ATGAAGGCCGTCGTATCCATTCCCGCAACGATAGCGCTTGTTGGGTACGCCTGGAAGAAAAAATCGCTGACGCCA
CTGGGCCTCGTCGCCGGTGCGCTAACCGCCGTTGTGCACGCCTGGCATCCGTGGAACCTTTCCTTTGTCCTACTC
CTGGTCTTCTTCTTGGCCGGCTCTCGGGCTACCCGTGTCAAGGAAAATGTCAAGGCTCACTTGACAACGCACTCT
CGGGGTAGCTCAGGGCCAGAGGGGCCCCGGACCCATGTTCAAGTCTTGGCAAACTCCCTCATGGGCTCTATTCTC
ACTCTTCTTCACGCTCTTCAACTACGTTGGCGAGCTGCTGCCTATGCCGACACTGGTTCGCCAAACCCGCATGGT
ACAATGTGCTTCTCGTGGGGCGGCGATCTTCTCGTCATCGGCATCATTGCAAATTACGCCTGCGTCACGGCCGAC
ACGTTTAGCTCAGAGCTTGGCATCTTGTCCCGGAGTGAACCACGGCTTATAACGTCTCCGACTCTGCGGAAAGTG
CCGCGGGGTACCAACGGGGGCGTCACCTTACTGGGTCTAGCGGCCGGTATATTGGGCTCTCTGATTATTGTGACA
GCTGCCATGTTAGCGCTGCCCGTCTGCACTCATGAAACGTCCCACTCGTTGGGAGGTGGCATTCCCTGGTCACTG
GAGCAACGAAGGGTTTTGATGATATTCTTGGTGATGTGGGGAATACTGGGGAGTCTCCTAGACAGTATTCTCGGG
GCCTTGTTTCAGCGATCTGTCCGTGACATTCGTTCAGGCAAAATTGTCGAGGGAGAAGGCGGCTGCCGCGTCCTC
GTGTCGGCCAGCACAGATGCCGTGGTTGGGGGTTCTGTCAAACGTGCCGAGGCCATGGCAGCAGCACTTGGCGGA
GAAGATGGCAGCACAGCTGCCCAGAAGCTCAACGCATGTGCTATTGACGAGGAACACGAAGAGACAGAAGTTCGG
ATACCACCAGAGAAGAAGCACCGCAAGTCGAGCTTCGGGGACGAACGGCCCTCACGTGTCGTGGAGAGTGGATGG
GATCTTCTCGACAATAATGATGTGAACTTTCTCATGGCATGTATGATGAGTGTCGGCGCCATGGCCGTGGCCAGT
TGGTACTGGGCTATTCCCTTGGAATCGCTGATGAGACCGTGA
Gene >OphauB2|5392
ATGAAGGCCGTCGTATCCATTCCCGCAACGATAGCGCTTGTTGGGTACGCCTGGAAGAAAAAATCGCTGACGCCA
CTGGGCCTCGTCGCCGGTGCGCTAACCGCCGTTGTGCACGCCTGGCATCCGTGGAACCTTTCCTTTGTCCTACTC
CTGGTCTTCTTCTTGGCCGGCTCTCGGGCTACCCGTGTTTGTTCAAGTCTGCCTTGTTCGTGTCGCGTCTGCTAA
CTTCTGGGGCAGGTCAAGGAAAATGTCAAGGCTCACTTGACAACGCACTCTCGGGGTAGCTCAGGGCCAGAGGGG
CCCCGGACCCATGTTCAAGGTTTATACATTTCCGCACCAGTTGTCTCGAACCTAGAAGACCACGGCTAACATGGA
CCTTGCAGTCTTGGCAAACTCCCTCATGGGCTCTATTCTCACTCTTCTTCACGCTCTTCAACTACGTTGGCGAGC
TGCTGCCTATGCCGACACTGGTTCGCCAAACCCGCATGGTACAATGTGCTTCTCGTGGGGCGGCGATCTTCTCGT
CATCGGCATCATTGCAAATTACGCCTGCGTCACGGCCGACACGTTTAGCTCAGAGCTTGGCATCTTGTCCCGGAG
TGAACCACGGCTTATAACGTCTCCGACTCTGCGGAAAGTGCCGCGGGGTACCAACGGGGGCGTCACCTTACTGGG
TCTAGCGGCCGGTATATTGGGCTCTCTGATTATTGTGACAGCTGCCATGTTAGCGCTGCCCGTCTGCACTCATGA
AACGTCCCACTCGTTGGGAGGTGGCATTCCCTGGTCACTGGAGCAACGAAGGGTTTTGATGATATTCTTGGTGAT
GTGGGGAATACTGGGGAGTCTCCTAGACAGTATTCTCGGGGCCTTGTTTCAGCGATCTGTCCGTGACATTCGTTC
AGGCAAAATTGTCGAGGGAGAAGGCGGCTGCCGCGTCCTCGTGTCGGCCAGCACAGATGCCGTGGTTGGGGGTTC
TGTCAAACGTGCCGAGGCCATGGCAGCAGCACTTGGCGGAGAAGATGGCAGCACAGCTGCCCAGAAGCTCAACGC
ATGTGCTATTGACGAGGAACACGAAGAGACAGAAGTTCGGATACCACCAGAGAAGAAGCACCGCAAGTCGAGCTT
CGGGGACGAACGGCCCTCACGTGTCGTGGAGAGTGGATGGGATCTTCTCGACAATAATGATGTGAACTTTCTCAT
GGCATGTATGATGAGTGTCGGCGCCATGGCCGTGGCCAGTTGGTACTGGGCTATTCCCTTGGAATCGCTGATGAG
ACCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail