Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5389
Gene name
LocationContig_41:7127..8601
Strand+
Gene length (bp)1474
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03114 BAR BAR domain 7.5E-67 6 246
PF00018 SH3_1 SH3 domain 1.5E-14 381 427
PF14604 SH3_9 Variant SH3 domain 1.0E-11 382 431
PF07653 SH3_2 Variant SH3 domain 5.9E-09 382 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 1 433 5.0E-146
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 1 434 1.0E-133
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 1 341 3.0E-112
sp|Q9UUM7|HOB3_SCHPO Protein hob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob3 PE=1 SV=1 1 247 2.0E-19
sp|P25343|RV161_YEAST Reduced viability upon starvation protein 161 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS161 PE=1 SV=1 1 238 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 1 433 5.0E-146
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 1 434 1.0E-133
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 1 341 3.0E-112
sp|Q9UUM7|HOB3_SCHPO Protein hob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob3 PE=1 SV=1 1 247 2.0E-19
sp|P25343|RV161_YEAST Reduced viability upon starvation protein 161 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS161 PE=1 SV=1 1 238 5.0E-16
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 340 433 1.0E-14
sp|Q5AFE4|RV161_CANAL Regulator of cytoskeleton and endocytosis RVS161 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS161 PE=1 SV=1 1 238 5.0E-13
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 359 434 2.0E-12
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 380 431 4.0E-12
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 380 431 4.0E-12
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 376 433 3.0E-11
sp|O08838|AMPH_RAT Amphiphysin OS=Rattus norvegicus GN=Amph PE=1 SV=1 4 258 3.0E-11
sp|B0BNA1|SH3Y1_RAT SH3 domain-containing YSC84-like protein 1 OS=Rattus norvegicus GN=Sh3yl1 PE=2 SV=1 380 434 4.0E-11
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 380 434 4.0E-11
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 380 434 4.0E-11
sp|Q7TQF7|AMPH_MOUSE Amphiphysin OS=Mus musculus GN=Amph PE=1 SV=1 4 258 5.0E-11
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 380 434 6.0E-11
sp|Q5RAQ2|SH3Y1_PONAB SH3 domain-containing YSC84-like protein 1 OS=Pongo abelii GN=SH3YL1 PE=2 SV=1 380 434 7.0E-11
sp|P49418|AMPH_HUMAN Amphiphysin OS=Homo sapiens GN=AMPH PE=1 SV=1 4 258 1.0E-10
sp|P50478|AMPH_CHICK Amphiphysin OS=Gallus gallus GN=AMPH PE=2 SV=1 4 290 2.0E-10
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 363 434 5.0E-10
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 354 432 7.0E-10
sp|O89100|GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus GN=Grap2 PE=1 SV=1 368 431 8.0E-10
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 358 431 9.0E-10
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 364 431 9.0E-10
sp|P70248|MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus GN=Myo1f PE=1 SV=1 313 431 2.0E-09
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 376 432 2.0E-09
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 342 433 2.0E-09
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 363 431 3.0E-09
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 341 431 3.0E-09
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 377 431 4.0E-09
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 353 431 4.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 343 433 4.0E-09
sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 368 431 6.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 368 435 8.0E-09
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 374 431 8.0E-09
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 363 435 9.0E-09
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 368 431 9.0E-09
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 380 431 1.0E-08
sp|O00160|MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens GN=MYO1F PE=1 SV=3 290 431 1.0E-08
sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 368 431 1.0E-08
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 326 433 1.0E-08
sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 368 431 1.0E-08
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 335 431 2.0E-08
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 364 432 2.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 368 431 2.0E-08
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 326 433 2.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 368 431 2.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 375 435 3.0E-08
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 332 433 3.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 368 435 3.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 375 435 3.0E-08
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 311 431 3.0E-08
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 369 432 4.0E-08
sp|Q6YKA8|DRK_DROSI Protein E(sev)2B OS=Drosophila simulans GN=drk PE=3 SV=1 374 431 4.0E-08
sp|Q08012|DRK_DROME Protein enhancer of sevenless 2B OS=Drosophila melanogaster GN=drk PE=1 SV=1 374 431 4.0E-08
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 380 431 4.0E-08
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 380 431 4.0E-08
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 380 431 4.0E-08
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 380 431 4.0E-08
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 311 431 4.0E-08
sp|Q99963|SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens GN=SH3GL3 PE=1 SV=1 360 433 4.0E-08
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 336 433 4.0E-08
sp|Q9NYB9|ABI2_HUMAN Abl interactor 2 OS=Homo sapiens GN=ABI2 PE=1 SV=1 377 431 6.0E-08
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 376 431 6.0E-08
sp|P62484|ABI2_MOUSE Abl interactor 2 OS=Mus musculus GN=Abi2 PE=1 SV=1 377 431 6.0E-08
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 351 431 6.0E-08
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 376 431 7.0E-08
sp|Q63356|MYO1E_RAT Unconventional myosin-Ie OS=Rattus norvegicus GN=Myo1e PE=1 SV=1 382 431 7.0E-08
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 352 432 7.0E-08
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 382 432 7.0E-08
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 360 431 8.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 378 432 1.0E-07
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 342 433 1.0E-07
sp|E9Q634|MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus GN=Myo1e PE=1 SV=1 382 431 1.0E-07
sp|Q12965|MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens GN=MYO1E PE=1 SV=2 382 431 1.0E-07
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 370 431 1.0E-07
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 382 433 1.0E-07
sp|Q68FR2|BIN2_RAT Bridging integrator 2 OS=Rattus norvegicus GN=Bin2 PE=1 SV=1 4 259 1.0E-07
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 377 431 1.0E-07
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 370 431 1.0E-07
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 382 433 1.0E-07
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 345 431 1.0E-07
sp|Q61140|BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus GN=Bcar1 PE=1 SV=2 374 433 2.0E-07
sp|Q63767|BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus GN=Bcar1 PE=1 SV=1 382 433 2.0E-07
sp|Q9UBW5|BIN2_HUMAN Bridging integrator 2 OS=Homo sapiens GN=BIN2 PE=1 SV=3 4 259 2.0E-07
sp|O35964|SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus GN=Sh3gl1 PE=1 SV=1 367 433 2.0E-07
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 368 431 2.0E-07
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 368 431 2.0E-07
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 381 431 2.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 368 435 3.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 352 432 3.0E-07
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 380 431 3.0E-07
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 372 432 3.0E-07
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 373 433 3.0E-07
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 373 433 4.0E-07
sp|Q5PPZ5|BIN3_XENLA Bridging integrator 3 homolog OS=Xenopus laevis GN=bin3 PE=2 SV=1 38 255 4.0E-07
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 361 431 5.0E-07
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 367 433 5.0E-07
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 346 433 5.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 346 433 6.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 375 431 6.0E-07
sp|Q7T2V3|M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis GN=map3k10 PE=1 SV=1 382 431 6.0E-07
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 382 433 6.0E-07
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 367 430 7.0E-07
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 361 431 8.0E-07
sp|Q62421|SH3G3_MOUSE Endophilin-A3 OS=Mus musculus GN=Sh3gl3 PE=1 SV=1 368 433 9.0E-07
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 355 431 9.0E-07
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 370 431 1.0E-06
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 376 431 1.0E-06
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 380 431 1.0E-06
sp|Q62415|ASPP1_MOUSE Apoptosis-stimulating of p53 protein 1 OS=Mus musculus GN=Ppp1r13b PE=1 SV=2 379 431 1.0E-06
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 376 432 1.0E-06
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 358 433 1.0E-06
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 358 433 2.0E-06
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 373 433 2.0E-06
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 373 433 2.0E-06
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 358 431 2.0E-06
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 381 431 2.0E-06
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 317 431 2.0E-06
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 375 432 2.0E-06
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 367 430 2.0E-06
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 369 433 2.0E-06
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 381 431 2.0E-06
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 378 431 2.0E-06
sp|Q9CX99|GRAP_MOUSE GRB2-related adapter protein OS=Mus musculus GN=Grap PE=1 SV=1 364 432 2.0E-06
sp|Q95UN8|M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster GN=slpr PE=1 SV=1 381 431 2.0E-06
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 380 432 2.0E-06
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 364 434 3.0E-06
sp|Q5I1X5|IASPP_MOUSE RelA-associated inhibitor OS=Mus musculus GN=Ppp1r13l PE=1 SV=1 379 430 3.0E-06
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 378 434 3.0E-06
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 369 433 3.0E-06
sp|Q8WUF5|IASPP_HUMAN RelA-associated inhibitor OS=Homo sapiens GN=PPP1R13L PE=1 SV=4 379 430 3.0E-06
sp|Q9QZM5|ABI1_RAT Abl interactor 1 OS=Rattus norvegicus GN=Abi1 PE=1 SV=3 377 431 3.0E-06
sp|Q8CBW3|ABI1_MOUSE Abl interactor 1 OS=Mus musculus GN=Abi1 PE=1 SV=3 377 431 3.0E-06
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 382 432 4.0E-06
sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 382 433 4.0E-06
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 377 431 4.0E-06
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 305 431 5.0E-06
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 375 433 5.0E-06
sp|Q8IZP0|ABI1_HUMAN Abl interactor 1 OS=Homo sapiens GN=ABI1 PE=1 SV=4 377 431 6.0E-06
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 367 433 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005515 protein binding Yes
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2576
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4534
Ophiocordyceps australis map64 (Brazil) OphauB2|5389 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00765
Ophiocordyceps camponoti-rufipedis Ophun1|6213
Ophiocordyceps kimflemingae Ophio5|4455
Ophiocordyceps subramaniannii Hirsu2|3860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5389
MSFKGFQKGLTRAPQQFKARFNIGEHTKDAVYIDAERRFQELETGTKKLHDESQKYFEAINGMLSHQLEFSKAMT
EIYKPISGRVSDPDSTKIEGNPEGINACEEYESILQELQETLAPELEMIENRIIHPANELLDVIKVIRKTVVKRE
HKRLDYDRHRTALKKLEDKKERSAKDEKAMWKAEGEVEQATQDFEYFNDLLKEELPRLFTLEQEFIQPLFQSFYY
MQLNIFYTLHERMQRCDIGYFDLTREIEEAFYDKRGDIQEQAETLAICRFKTTGRPRPVRPANRPALEGGKRPAL
LTAGPSSAASGSKASAALHSPQSPSSSSDHAQSHNPPPPYSPSHKSTSPNLAVIAAAKAKPPPPKPKPSRLSAVP
TVETVTALYDYSAQAEGDLSFRTGDVIEIVQRTQNDNEWWTGKLHGKEGQFPGNYVRVNS*
Coding >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAA
CATACAAAGGATGCCGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCAC
GATGAATCACAAAAATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACA
GAAATCTACAAGCCCATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATC
AACGCCTGCGAAGAATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAG
AATAGGATAATCCACCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAA
CACAAGCGTCTTGACTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAG
GACGAAAAGGCCATGTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTG
CTCAAGGAAGAGCTGCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTAC
ATGCAGCTCAACATCTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGC
GAAATCGAAGAGGCCTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTC
AAAACGACTGGCCGCCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTG
CTTACTGCAGGACCCAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCA
AGCTCGTCAGATCACGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAAT
TTGGCCGTCATTGCCGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCC
ACTGTGGAGACTGTCACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGAC
GTTATCGAAATAGTTCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAA
TTCCCAGGCAACTACGTCCGAGTAAATTCATGA
Transcript >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAA
CATACAAAGGATGCCGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCAC
GATGAATCACAAAAATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACA
GAAATCTACAAGCCCATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATC
AACGCCTGCGAAGAATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAG
AATAGGATAATCCACCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAA
CACAAGCGTCTTGACTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAG
GACGAAAAGGCCATGTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTG
CTCAAGGAAGAGCTGCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTAC
ATGCAGCTCAACATCTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGC
GAAATCGAAGAGGCCTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTC
AAAACGACTGGCCGCCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTG
CTTACTGCAGGACCCAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCA
AGCTCGTCAGATCACGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAAT
TTGGCCGTCATTGCCGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCC
ACTGTGGAGACTGTCACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGAC
GTTATCGAAATAGTTCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAA
TTCCCAGGCAACTACGTCCGAGTAAATTCATGA
Gene >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGTGCGCTCCTACATAGTGTCTTGCAACAGAATGCTTGCT
GACTGACGACTCTTTTCTGCAGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAACATACAAAGGATGC
CGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCACGATGAATCACAAAA
ATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACAGAAATCTACAAGCC
CATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATCAACGCCTGCGAAGA
ATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAGAATAGGATAATCCA
CCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAACACAAGCGTCTTGA
CTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAGGACGAAAAGGCCAT
GTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTGCTCAAGGAAGAGCT
GCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTACATGCAGCTCAACAT
CTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGCGAAATCGAAGAGGC
CTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTCAAAACGACTGGCCG
CCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTGCTTACTGCAGGACC
CAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCAAGCTCGTCAGATCA
CGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAATTTGGCCGTCATTGC
CGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCCACTGTGGAGACTGT
CACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGACGTTATCGAAATAGT
TCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAATTCCCAGGTATGTT
GCAACTCTTTTTTTTTCCCTGCCCCTAAATATCCTTTTCCTTTCTAGCCTTTAACCAGAAACACCATTGTGCCGG
GAGCCTGGCTGACCTTTTTACAGGCAACTACGTCCGAGTAAATTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail