Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5389
Gene name
LocationContig_41:7127..8601
Strand+
Gene length (bp)1474
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03114 BAR BAR domain 7.5E-67 6 246
PF00018 SH3_1 SH3 domain 1.5E-14 381 427
PF14604 SH3_9 Variant SH3 domain 1.0E-11 382 431
PF07653 SH3_2 Variant SH3 domain 5.9E-09 382 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 1 433 5.0E-146
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 1 434 1.0E-133
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 1 341 3.0E-112
sp|Q9UUM7|HOB3_SCHPO Protein hob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob3 PE=1 SV=1 1 247 2.0E-19
sp|P25343|RV161_YEAST Reduced viability upon starvation protein 161 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS161 PE=1 SV=1 1 238 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 1 433 5.0E-146
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 1 434 1.0E-133
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 1 341 3.0E-112
sp|Q9UUM7|HOB3_SCHPO Protein hob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob3 PE=1 SV=1 1 247 2.0E-19
sp|P25343|RV161_YEAST Reduced viability upon starvation protein 161 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS161 PE=1 SV=1 1 238 5.0E-16
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 340 433 1.0E-14
sp|Q5AFE4|RV161_CANAL Regulator of cytoskeleton and endocytosis RVS161 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS161 PE=1 SV=1 1 238 5.0E-13
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 359 434 2.0E-12
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 380 431 4.0E-12
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 380 431 4.0E-12
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 376 433 3.0E-11
sp|O08838|AMPH_RAT Amphiphysin OS=Rattus norvegicus GN=Amph PE=1 SV=1 4 258 3.0E-11
sp|B0BNA1|SH3Y1_RAT SH3 domain-containing YSC84-like protein 1 OS=Rattus norvegicus GN=Sh3yl1 PE=2 SV=1 380 434 4.0E-11
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 380 434 4.0E-11
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 380 434 4.0E-11
sp|Q7TQF7|AMPH_MOUSE Amphiphysin OS=Mus musculus GN=Amph PE=1 SV=1 4 258 5.0E-11
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 380 434 6.0E-11
sp|Q5RAQ2|SH3Y1_PONAB SH3 domain-containing YSC84-like protein 1 OS=Pongo abelii GN=SH3YL1 PE=2 SV=1 380 434 7.0E-11
sp|P49418|AMPH_HUMAN Amphiphysin OS=Homo sapiens GN=AMPH PE=1 SV=1 4 258 1.0E-10
sp|P50478|AMPH_CHICK Amphiphysin OS=Gallus gallus GN=AMPH PE=2 SV=1 4 290 2.0E-10
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 363 434 5.0E-10
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 354 432 7.0E-10
sp|O89100|GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus GN=Grap2 PE=1 SV=1 368 431 8.0E-10
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 358 431 9.0E-10
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 364 431 9.0E-10
sp|P70248|MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus GN=Myo1f PE=1 SV=1 313 431 2.0E-09
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 376 432 2.0E-09
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 342 433 2.0E-09
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 363 431 3.0E-09
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 341 431 3.0E-09
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 377 431 4.0E-09
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 353 431 4.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 343 433 4.0E-09
sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 368 431 6.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 368 435 8.0E-09
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 374 431 8.0E-09
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 363 435 9.0E-09
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 368 431 9.0E-09
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 380 431 1.0E-08
sp|O00160|MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens GN=MYO1F PE=1 SV=3 290 431 1.0E-08
sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 368 431 1.0E-08
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 326 433 1.0E-08
sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 368 431 1.0E-08
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 335 431 2.0E-08
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 364 432 2.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 368 431 2.0E-08
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 326 433 2.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 368 431 2.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 375 435 3.0E-08
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 332 433 3.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 368 435 3.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 375 435 3.0E-08
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 311 431 3.0E-08
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 369 432 4.0E-08
sp|Q6YKA8|DRK_DROSI Protein E(sev)2B OS=Drosophila simulans GN=drk PE=3 SV=1 374 431 4.0E-08
sp|Q08012|DRK_DROME Protein enhancer of sevenless 2B OS=Drosophila melanogaster GN=drk PE=1 SV=1 374 431 4.0E-08
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 380 431 4.0E-08
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 380 431 4.0E-08
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 380 431 4.0E-08
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 380 431 4.0E-08
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 311 431 4.0E-08
sp|Q99963|SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens GN=SH3GL3 PE=1 SV=1 360 433 4.0E-08
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 336 433 4.0E-08
sp|Q9NYB9|ABI2_HUMAN Abl interactor 2 OS=Homo sapiens GN=ABI2 PE=1 SV=1 377 431 6.0E-08
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 376 431 6.0E-08
sp|P62484|ABI2_MOUSE Abl interactor 2 OS=Mus musculus GN=Abi2 PE=1 SV=1 377 431 6.0E-08
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 351 431 6.0E-08
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 376 431 7.0E-08
sp|Q63356|MYO1E_RAT Unconventional myosin-Ie OS=Rattus norvegicus GN=Myo1e PE=1 SV=1 382 431 7.0E-08
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 352 432 7.0E-08
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 382 432 7.0E-08
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 360 431 8.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 378 432 1.0E-07
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 342 433 1.0E-07
sp|E9Q634|MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus GN=Myo1e PE=1 SV=1 382 431 1.0E-07
sp|Q12965|MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens GN=MYO1E PE=1 SV=2 382 431 1.0E-07
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 370 431 1.0E-07
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 382 433 1.0E-07
sp|Q68FR2|BIN2_RAT Bridging integrator 2 OS=Rattus norvegicus GN=Bin2 PE=1 SV=1 4 259 1.0E-07
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 377 431 1.0E-07
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 370 431 1.0E-07
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 382 433 1.0E-07
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 345 431 1.0E-07
sp|Q61140|BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus GN=Bcar1 PE=1 SV=2 374 433 2.0E-07
sp|Q63767|BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus GN=Bcar1 PE=1 SV=1 382 433 2.0E-07
sp|Q9UBW5|BIN2_HUMAN Bridging integrator 2 OS=Homo sapiens GN=BIN2 PE=1 SV=3 4 259 2.0E-07
sp|O35964|SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus GN=Sh3gl1 PE=1 SV=1 367 433 2.0E-07
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 368 431 2.0E-07
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 368 431 2.0E-07
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 381 431 2.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 368 435 3.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 352 432 3.0E-07
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 380 431 3.0E-07
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 372 432 3.0E-07
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 373 433 3.0E-07
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 373 433 4.0E-07
sp|Q5PPZ5|BIN3_XENLA Bridging integrator 3 homolog OS=Xenopus laevis GN=bin3 PE=2 SV=1 38 255 4.0E-07
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 361 431 5.0E-07
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 367 433 5.0E-07
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 346 433 5.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 346 433 6.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 375 431 6.0E-07
sp|Q7T2V3|M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis GN=map3k10 PE=1 SV=1 382 431 6.0E-07
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 382 433 6.0E-07
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 367 430 7.0E-07
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 361 431 8.0E-07
sp|Q62421|SH3G3_MOUSE Endophilin-A3 OS=Mus musculus GN=Sh3gl3 PE=1 SV=1 368 433 9.0E-07
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 355 431 9.0E-07
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 370 431 1.0E-06
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 376 431 1.0E-06
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 380 431 1.0E-06
sp|Q62415|ASPP1_MOUSE Apoptosis-stimulating of p53 protein 1 OS=Mus musculus GN=Ppp1r13b PE=1 SV=2 379 431 1.0E-06
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 376 432 1.0E-06
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 358 433 1.0E-06
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 358 433 2.0E-06
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 373 433 2.0E-06
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 373 433 2.0E-06
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 358 431 2.0E-06
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 381 431 2.0E-06
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 317 431 2.0E-06
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 375 432 2.0E-06
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 367 430 2.0E-06
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 369 433 2.0E-06
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 381 431 2.0E-06
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 378 431 2.0E-06
sp|Q9CX99|GRAP_MOUSE GRB2-related adapter protein OS=Mus musculus GN=Grap PE=1 SV=1 364 432 2.0E-06
sp|Q95UN8|M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster GN=slpr PE=1 SV=1 381 431 2.0E-06
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 380 432 2.0E-06
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 364 434 3.0E-06
sp|Q5I1X5|IASPP_MOUSE RelA-associated inhibitor OS=Mus musculus GN=Ppp1r13l PE=1 SV=1 379 430 3.0E-06
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 378 434 3.0E-06
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 369 433 3.0E-06
sp|Q8WUF5|IASPP_HUMAN RelA-associated inhibitor OS=Homo sapiens GN=PPP1R13L PE=1 SV=4 379 430 3.0E-06
sp|Q9QZM5|ABI1_RAT Abl interactor 1 OS=Rattus norvegicus GN=Abi1 PE=1 SV=3 377 431 3.0E-06
sp|Q8CBW3|ABI1_MOUSE Abl interactor 1 OS=Mus musculus GN=Abi1 PE=1 SV=3 377 431 3.0E-06
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 382 432 4.0E-06
sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 382 433 4.0E-06
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 377 431 4.0E-06
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 305 431 5.0E-06
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 375 433 5.0E-06
sp|Q8IZP0|ABI1_HUMAN Abl interactor 1 OS=Homo sapiens GN=ABI1 PE=1 SV=4 377 431 6.0E-06
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 367 433 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005515 protein binding Yes
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5389
MSFKGFQKGLTRAPQQFKARFNIGEHTKDAVYIDAERRFQELETGTKKLHDESQKYFEAINGMLSHQLEFSKAMT
EIYKPISGRVSDPDSTKIEGNPEGINACEEYESILQELQETLAPELEMIENRIIHPANELLDVIKVIRKTVVKRE
HKRLDYDRHRTALKKLEDKKERSAKDEKAMWKAEGEVEQATQDFEYFNDLLKEELPRLFTLEQEFIQPLFQSFYY
MQLNIFYTLHERMQRCDIGYFDLTREIEEAFYDKRGDIQEQAETLAICRFKTTGRPRPVRPANRPALEGGKRPAL
LTAGPSSAASGSKASAALHSPQSPSSSSDHAQSHNPPPPYSPSHKSTSPNLAVIAAAKAKPPPPKPKPSRLSAVP
TVETVTALYDYSAQAEGDLSFRTGDVIEIVQRTQNDNEWWTGKLHGKEGQFPGNYVRVNS*
Coding >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAA
CATACAAAGGATGCCGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCAC
GATGAATCACAAAAATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACA
GAAATCTACAAGCCCATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATC
AACGCCTGCGAAGAATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAG
AATAGGATAATCCACCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAA
CACAAGCGTCTTGACTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAG
GACGAAAAGGCCATGTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTG
CTCAAGGAAGAGCTGCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTAC
ATGCAGCTCAACATCTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGC
GAAATCGAAGAGGCCTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTC
AAAACGACTGGCCGCCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTG
CTTACTGCAGGACCCAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCA
AGCTCGTCAGATCACGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAAT
TTGGCCGTCATTGCCGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCC
ACTGTGGAGACTGTCACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGAC
GTTATCGAAATAGTTCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAA
TTCCCAGGCAACTACGTCCGAGTAAATTCATGA
Transcript >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAA
CATACAAAGGATGCCGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCAC
GATGAATCACAAAAATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACA
GAAATCTACAAGCCCATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATC
AACGCCTGCGAAGAATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAG
AATAGGATAATCCACCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAA
CACAAGCGTCTTGACTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAG
GACGAAAAGGCCATGTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTG
CTCAAGGAAGAGCTGCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTAC
ATGCAGCTCAACATCTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGC
GAAATCGAAGAGGCCTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTC
AAAACGACTGGCCGCCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTG
CTTACTGCAGGACCCAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCA
AGCTCGTCAGATCACGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAAT
TTGGCCGTCATTGCCGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCC
ACTGTGGAGACTGTCACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGAC
GTTATCGAAATAGTTCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAA
TTCCCAGGCAACTACGTCCGAGTAAATTCATGA
Gene >OphauB2|5389
ATGAGCTTCAAGGGCTTTCAAAAGGGCCTGACTCGGGTGCGCTCCTACATAGTGTCTTGCAACAGAATGCTTGCT
GACTGACGACTCTTTTCTGCAGGCGCCGCAGCAGTTCAAGGCACGCTTCAACATTGGTGAACATACAAAGGATGC
CGTCTACATCGATGCCGAGCGCCGCTTCCAGGAGCTCGAGACGGGAACCAAAAAGCTGCACGATGAATCACAAAA
ATACTTCGAGGCCATCAATGGCATGCTCTCGCACCAGCTCGAGTTCAGCAAGGCCATGACAGAAATCTACAAGCC
CATTTCGGGTCGCGTCTCGGACCCCGATTCGACCAAAATCGAAGGCAACCCCGAAGGCATCAACGCCTGCGAAGA
ATACGAAAGCATATTACAGGAACTCCAGGAGACGCTAGCTCCCGAGCTGGAAATGATTGAGAATAGGATAATCCA
CCCAGCAAACGAGCTCCTAGACGTCATCAAGGTGATACGGAAAACCGTTGTCAAGCGCGAACACAAGCGTCTTGA
CTACGATCGCCATCGCACCGCTCTCAAGAAGCTTGAGGATAAGAAAGAGCGCTCCGCAAAGGACGAAAAGGCCAT
GTGGAAGGCCGAGGGCGAGGTGGAGCAAGCCACCCAAGACTTTGAATATTTCAATGACTTGCTCAAGGAAGAGCT
GCCCCGACTCTTTACTCTAGAGCAAGAGTTTATTCAGCCCTTGTTCCAGTCTTTCTACTACATGCAGCTCAACAT
CTTCTACACACTGCACGAGCGCATGCAGCGGTGCGATATTGGCTACTTTGACTTGACACGCGAAATCGAAGAGGC
CTTTTACGATAAACGCGGCGACATACAAGAACAGGCCGAGACTCTGGCCATTTGTCGCTTCAAAACGACTGGCCG
CCCCCGTCCAGTTCGTCCCGCCAACCGCCCGGCTCTCGAAGGAGGCAAGCGGCCCGCCCTGCTTACTGCAGGACC
CAGCTCTGCTGCCTCGGGATCCAAAGCTTCTGCTGCGCTTCATTCTCCCCAGTCGCCTTCAAGCTCGTCAGATCA
CGCTCAGAGCCACAATCCGCCTCCACCCTACTCTCCCAGCCACAAGTCGACGAGTCCAAATTTGGCCGTCATTGC
CGCGGCAAAAGCCAAGCCTCCGCCACCCAAGCCCAAGCCAAGCCGTCTCAGCGCAGTGCCCACTGTGGAGACTGT
CACGGCCTTGTACGACTACTCGGCGCAAGCAGAGGGGGACTTGAGTTTTCGCACCGGCGACGTTATCGAAATAGT
TCAGCGTACGCAAAATGACAATGAGTGGTGGACGGGGAAGCTGCACGGTAAGGAAGGGCAATTCCCAGGTATGTT
GCAACTCTTTTTTTTTCCCTGCCCCTAAATATCCTTTTCCTTTCTAGCCTTTAACCAGAAACACCATTGTGCCGG
GAGCCTGGCTGACCTTTTTACAGGCAACTACGTCCGAGTAAATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail