Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5388
Gene name
LocationContig_41:4784..6439
Strand-
Gene length (bp)1655
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 5.8E-92 109 473
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 1.3E-05 154 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0DN31|NFS1_ARTBC Cysteine desulfurase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-2 PE=3 SV=1 1 508 0.0E+00
sp|P87185|NFS1_CANAL Cysteine desulfurase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NFS1 PE=2 SV=1 32 508 0.0E+00
sp|P87187|NFS1_CANMA Cysteine desulfurase, mitochondrial OS=Candida maltosa GN=SPL1 PE=3 SV=1 105 508 0.0E+00
sp|P25374|NFS1_YEAST Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFS1 PE=1 SV=2 105 508 0.0E+00
sp|O74351|NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21D10.11c PE=3 SV=2 25 508 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0DN31|NFS1_ARTBC Cysteine desulfurase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-2 PE=3 SV=1 1 508 0.0E+00
sp|P87185|NFS1_CANAL Cysteine desulfurase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NFS1 PE=2 SV=1 32 508 0.0E+00
sp|P87187|NFS1_CANMA Cysteine desulfurase, mitochondrial OS=Candida maltosa GN=SPL1 PE=3 SV=1 105 508 0.0E+00
sp|P25374|NFS1_YEAST Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFS1 PE=1 SV=2 105 508 0.0E+00
sp|O74351|NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21D10.11c PE=3 SV=2 25 508 0.0E+00
sp|O60028|NFS1_ASHGO Cysteine desulfurase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NFS1 PE=3 SV=1 23 508 0.0E+00
sp|Q9Y697|NFS1_HUMAN Cysteine desulfurase, mitochondrial OS=Homo sapiens GN=NFS1 PE=1 SV=3 107 508 0.0E+00
sp|Q5RDE7|NFS1_PONAB Cysteine desulfurase, mitochondrial OS=Pongo abelii GN=NFS1 PE=2 SV=1 107 508 0.0E+00
sp|Q9VKD3|NFS1_DROME Probable cysteine desulfurase, mitochondrial OS=Drosophila melanogaster GN=CG12264 PE=2 SV=1 107 508 0.0E+00
sp|Q9Z1J3|NFS1_MOUSE Cysteine desulfurase, mitochondrial OS=Mus musculus GN=Nfs1 PE=1 SV=3 107 508 0.0E+00
sp|Q99P39|NFS1_RAT Cysteine desulfurase, mitochondrial OS=Rattus norvegicus GN=Nfs1 PE=2 SV=1 107 508 0.0E+00
sp|Q54X04|NFS1_DICDI Probable cysteine desulfurase, mitochondrial OS=Dictyostelium discoideum GN=nfs1 PE=1 SV=1 106 507 0.0E+00
sp|O49543|MNIF1_ARATH Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana GN=NIFS1 PE=1 SV=1 107 508 0.0E+00
sp|Q92HP1|ISCS_RICCN Cysteine desulfurase IscS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|C3PNQ8|ISCS_RICAE Cysteine desulfurase IscS OS=Rickettsia africae (strain ESF-5) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8F204|ISCS_RICM5 Cysteine desulfurase IscS OS=Rickettsia massiliae (strain Mtu5) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q4UL77|ISCS_RICFE Cysteine desulfurase IscS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=iscS PE=3 SV=2 108 508 0.0E+00
sp|C4K1Z7|ISCS_RICPU Cysteine desulfurase IscS OS=Rickettsia peacockii (strain Rustic) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8GSG4|ISCS_RICRS Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Sheila Smith) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|B0BXX6|ISCS_RICRO Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Iowa) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8GWB2|ISCS_RICB8 Cysteine desulfurase IscS OS=Rickettsia bellii (strain OSU 85-389) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q9ZD60|ISCS_RICPR Cysteine desulfurase IscS OS=Rickettsia prowazekii (strain Madrid E) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q1RHY6|ISCS_RICBR Cysteine desulfurase IscS OS=Rickettsia bellii (strain RML369-C) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8GNU0|ISCS_RICAH Cysteine desulfurase IscS OS=Rickettsia akari (strain Hartford) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q68WP6|ISCS_RICTY Cysteine desulfurase IscS OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8EYH9|ISCS_RICCK Cysteine desulfurase IscS OS=Rickettsia canadensis (strain McKiel) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q8SQS2|NFS1_ENCCU Cysteine desulfurase, mitosomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=NFS1 PE=3 SV=1 95 506 0.0E+00
sp|Q8EEU9|ISCS_SHEON Cysteine desulfurase IscS OS=Shewanella oneidensis (strain MR-1) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A3QFD5|ISCS_SHELP Cysteine desulfurase IscS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|A8FXA5|ISCS_SHESH Cysteine desulfurase IscS OS=Shewanella sediminis (strain HAW-EB3) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|B8F356|ISCS_HAEPS Cysteine desulfurase IscS OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=iscS PE=3 SV=1 108 508 0.0E+00
sp|Q080P6|ISCS_SHEFN Cysteine desulfurase IscS OS=Shewanella frigidimarina (strain NCIMB 400) GN=iscS PE=3 SV=1 108 508 2.0E-180
sp|B1KNI3|ISCS_SHEWM Cysteine desulfurase IscS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=iscS PE=3 SV=1 108 508 3.0E-179
sp|A6TCF1|ISCS_KLEP7 Cysteine desulfurase IscS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iscS PE=3 SV=1 108 508 8.0E-179
sp|Q47EN5|ISCS_DECAR Cysteine desulfurase IscS OS=Dechloromonas aromatica (strain RCB) GN=iscS PE=3 SV=1 108 508 1.0E-178
sp|C4L7K2|ISCS_TOLAT Cysteine desulfurase IscS OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=iscS PE=3 SV=1 108 508 2.0E-178
sp|B5XNJ7|ISCS_KLEP3 Cysteine desulfurase IscS OS=Klebsiella pneumoniae (strain 342) GN=iscS PE=3 SV=1 108 508 2.0E-178
sp|A0KJ32|ISCS_AERHH Cysteine desulfurase IscS OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=iscS PE=3 SV=1 108 508 2.0E-178
sp|Q12P83|ISCS_SHEDO Cysteine desulfurase IscS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=iscS PE=3 SV=1 108 508 2.0E-178
sp|B8CMW5|ISCS_SHEPW Cysteine desulfurase IscS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=iscS PE=3 SV=1 108 508 3.0E-178
sp|A1S544|ISCS_SHEAM Cysteine desulfurase IscS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=iscS PE=3 SV=1 108 508 3.0E-178
sp|C6DBJ1|ISCS_PECCP Cysteine desulfurase IscS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=iscS PE=3 SV=1 108 508 3.0E-178
sp|Q7MNG2|ISCS_VIBVY Cysteine desulfurase IscS OS=Vibrio vulnificus (strain YJ016) GN=iscS PE=3 SV=1 108 508 7.0E-178
sp|Q486Z0|ISCS_COLP3 Cysteine desulfurase IscS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=iscS PE=3 SV=1 108 508 1.0E-177
sp|A8H2M6|ISCS_SHEPA Cysteine desulfurase IscS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=iscS PE=3 SV=1 108 508 2.0E-177
sp|Q8ZN40|ISCS_SALTY Cysteine desulfurase IscS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B5BAW6|ISCS_SALPK Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain AKU_12601) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|A9N1X5|ISCS_SALPB Cysteine desulfurase IscS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|Q5PNG1|ISCS_SALPA Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B4T0S2|ISCS_SALNS Cysteine desulfurase IscS OS=Salmonella newport (strain SL254) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B4TDB6|ISCS_SALHS Cysteine desulfurase IscS OS=Salmonella heidelberg (strain SL476) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B5RD12|ISCS_SALG2 Cysteine desulfurase IscS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B5R5A2|ISCS_SALEP Cysteine desulfurase IscS OS=Salmonella enteritidis PT4 (strain P125109) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B5FR85|ISCS_SALDC Cysteine desulfurase IscS OS=Salmonella dublin (strain CT_02021853) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|Q57LG9|ISCS_SALCH Cysteine desulfurase IscS OS=Salmonella choleraesuis (strain SC-B67) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B5F1C0|ISCS_SALA4 Cysteine desulfurase IscS OS=Salmonella agona (strain SL483) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|B4TRX5|ISCS_SALSV Cysteine desulfurase IscS OS=Salmonella schwarzengrund (strain CVM19633) GN=iscS PE=3 SV=1 108 508 3.0E-177
sp|Q8DEY7|ISCS_VIBVU Cysteine desulfurase IscS OS=Vibrio vulnificus (strain CMCP6) GN=iscS PE=3 SV=1 108 508 4.0E-177
sp|A4SP14|ISCS_AERS4 Cysteine desulfurase IscS OS=Aeromonas salmonicida (strain A449) GN=iscS PE=3 SV=1 108 508 4.0E-177
sp|Q87S28|ISCS_VIBPA Cysteine desulfurase IscS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=iscS PE=3 SV=1 108 508 4.0E-177
sp|Q8Z4N0|ISCS_SALTI Cysteine desulfurase IscS OS=Salmonella typhi GN=iscS PE=3 SV=1 108 508 7.0E-177
sp|A9MHJ4|ISCS_SALAR Cysteine desulfurase IscS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=iscS PE=3 SV=1 108 508 7.0E-177
sp|Q0HJF4|ISCS_SHESM Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-4) GN=iscS PE=3 SV=1 108 508 1.0E-176
sp|A7MU48|ISCS_VIBCB Cysteine desulfurase IscS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=iscS PE=3 SV=1 108 508 1.0E-176
sp|A8GHY3|ISCS_SERP5 Cysteine desulfurase IscS OS=Serratia proteamaculans (strain 568) GN=iscS PE=3 SV=1 108 508 1.0E-176
sp|Q1H361|ISCS_METFK Cysteine desulfurase IscS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=iscS PE=3 SV=1 108 508 1.0E-176
sp|Q0HVP4|ISCS_SHESR Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-7) GN=iscS PE=3 SV=1 108 508 2.0E-176
sp|A0KXJ0|ISCS_SHESA Cysteine desulfurase IscS OS=Shewanella sp. (strain ANA-3) GN=iscS PE=3 SV=1 108 508 2.0E-176
sp|Q7N224|ISCS_PHOLL Cysteine desulfurase IscS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|P0A6C0|ISCS_SHIFL Cysteine desulfurase IscS OS=Shigella flexneri GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|Q0T1Y9|ISCS_SHIF8 Cysteine desulfurase IscS OS=Shigella flexneri serotype 5b (strain 8401) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B2TXV5|ISCS_SHIB3 Cysteine desulfurase IscS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B1LNI6|ISCS_ECOSM Cysteine desulfurase IscS OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B6I5A2|ISCS_ECOSE Cysteine desulfurase IscS OS=Escherichia coli (strain SE11) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7N6B7|ISCS_ECOLU Cysteine desulfurase IscS OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|P0A6B7|ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) GN=iscS PE=1 SV=1 108 508 3.0E-176
sp|B1IWD1|ISCS_ECOLC Cysteine desulfurase IscS OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|P0A6B8|ISCS_ECOL6 Cysteine desulfurase IscS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|Q0TEV5|ISCS_ECOL5 Cysteine desulfurase IscS OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|A8A336|ISCS_ECOHS Cysteine desulfurase IscS OS=Escherichia coli O9:H4 (strain HS) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B1XB05|ISCS_ECODH Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / DH10B) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|C4ZXA5|ISCS_ECOBW Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7M7N3|ISCS_ECO8A Cysteine desulfurase IscS OS=Escherichia coli O8 (strain IAI1) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7MYG3|ISCS_ECO81 Cysteine desulfurase IscS OS=Escherichia coli O81 (strain ED1a) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7NRH9|ISCS_ECO7I Cysteine desulfurase IscS OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B5Z104|ISCS_ECO5E Cysteine desulfurase IscS OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|P0A6B9|ISCS_ECO57 Cysteine desulfurase IscS OS=Escherichia coli O157:H7 GN=iscS PE=1 SV=1 108 508 3.0E-176
sp|B7LDC2|ISCS_ECO55 Cysteine desulfurase IscS OS=Escherichia coli (strain 55989 / EAEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7MIM0|ISCS_ECO45 Cysteine desulfurase IscS OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|B7UGX6|ISCS_ECO27 Cysteine desulfurase IscS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|A7ZPX4|ISCS_ECO24 Cysteine desulfurase IscS OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iscS PE=3 SV=1 108 508 3.0E-176
sp|A7MGX8|ISCS_CROS8 Cysteine desulfurase IscS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=iscS PE=3 SV=1 108 508 4.0E-176
sp|C0PYK7|ISCS_SALPC Cysteine desulfurase IscS OS=Salmonella paratyphi C (strain RKS4594) GN=iscS PE=3 SV=1 108 508 4.0E-176
sp|Q6LU62|ISCS_PHOPR Cysteine desulfurase IscS OS=Photobacterium profundum GN=iscS PE=3 SV=1 108 508 5.0E-176
sp|A1RJ52|ISCS_SHESW Cysteine desulfurase IscS OS=Shewanella sp. (strain W3-18-1) GN=iscS PE=3 SV=1 108 508 7.0E-176
sp|A4Y7D7|ISCS_SHEPC Cysteine desulfurase IscS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=iscS PE=3 SV=1 108 508 7.0E-176
sp|Q9KTY2|ISCS_VIBCH Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=iscS PE=3 SV=1 108 508 1.0E-175
sp|A5F3G4|ISCS_VIBC3 Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=iscS PE=3 SV=1 108 508 1.0E-175
sp|B7LKA9|ISCS_ESCF3 Cysteine desulfurase IscS OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=iscS PE=3 SV=1 108 508 2.0E-175
sp|C3LT01|ISCS_VIBCM Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain M66-2) GN=iscS PE=3 SV=1 108 508 2.0E-175
sp|B0TNY1|ISCS_SHEHH Cysteine desulfurase IscS OS=Shewanella halifaxensis (strain HAW-EB4) GN=iscS PE=3 SV=1 108 508 2.0E-175
sp|A4WDB1|ISCS_ENT38 Cysteine desulfurase IscS OS=Enterobacter sp. (strain 638) GN=iscS PE=3 SV=1 108 508 4.0E-175
sp|Q6D259|ISCS_PECAS Cysteine desulfurase IscS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=iscS PE=3 SV=1 108 508 9.0E-175
sp|Q2GGJ4|ISCS_EHRCR Cysteine desulfurase IscS OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=iscS PE=3 SV=1 102 508 1.0E-174
sp|P57803|ISCS_PASMU Cysteine desulfurase IscS OS=Pasteurella multocida (strain Pm70) GN=iscS PE=3 SV=1 108 508 1.0E-174
sp|Q65RS7|ISCS_MANSM Cysteine desulfurase IscS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=iscS PE=3 SV=1 108 508 3.0E-173
sp|B8E9D2|ISCS_SHEB2 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS223) GN=iscS PE=3 SV=1 108 508 4.0E-173
sp|A9L3R0|ISCS_SHEB9 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS195) GN=iscS PE=3 SV=1 108 508 4.0E-173
sp|A6WNY5|ISCS_SHEB8 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS185) GN=iscS PE=3 SV=1 108 508 4.0E-173
sp|B7VJS6|ISCS_VIBTL Cysteine desulfurase IscS OS=Vibrio tasmaniensis (strain LGP32) GN=iscS PE=3 SV=1 108 508 5.0E-173
sp|B4EZU8|ISCS_PROMH Cysteine desulfurase IscS OS=Proteus mirabilis (strain HI4320) GN=iscS PE=3 SV=1 108 508 8.0E-173
sp|A9M029|ISCS_NEIM0 Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup C (strain 053442) GN=iscS PE=3 SV=1 106 508 1.0E-172
sp|B0UVL5|ISCS_HISS2 Cysteine desulfurase IscS OS=Histophilus somni (strain 2336) GN=iscS PE=3 SV=1 108 508 1.0E-172
sp|A3D577|ISCS_SHEB5 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=iscS PE=3 SV=1 108 508 1.0E-172
sp|B0YLW6|NFS1_TRAHO Cysteine desulfurase, mitosomal OS=Trachipleistophora hominis GN=NFS1 PE=1 SV=1 109 506 2.0E-172
sp|Q0I1L2|ISCS_HAES1 Cysteine desulfurase IscS OS=Haemophilus somnus (strain 129Pt) GN=iscS PE=3 SV=1 108 508 6.0E-172
sp|A1KUK1|ISCS_NEIMF Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=iscS PE=3 SV=1 106 508 8.0E-172
sp|A6VMN7|ISCS_ACTSZ Cysteine desulfurase IscS OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=iscS PE=3 SV=1 108 508 1.0E-171
sp|Q3IFI3|ISCS_PSEHT Cysteine desulfurase IscS OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=iscS PE=3 SV=1 108 508 1.0E-171
sp|Q57337|ISCS_HAEIN Cysteine desulfurase IscS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscS PE=3 SV=2 108 508 2.0E-171
sp|A5UGI1|ISCS_HAEIG Cysteine desulfurase IscS OS=Haemophilus influenzae (strain PittGG) GN=iscS PE=3 SV=1 108 508 2.0E-171
sp|Q9JTX0|ISCS_NEIMA Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=iscS PE=3 SV=1 106 508 5.0E-171
sp|A5UAA8|ISCS_HAEIE Cysteine desulfurase IscS OS=Haemophilus influenzae (strain PittEE) GN=iscS PE=3 SV=1 108 508 7.0E-171
sp|B4RMB8|ISCS_NEIG2 Cysteine desulfurase IscS OS=Neisseria gonorrhoeae (strain NCCP11945) GN=iscS PE=3 SV=1 106 508 2.0E-170
sp|Q5F8X4|ISCS_NEIG1 Cysteine desulfurase IscS OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=iscS PE=3 SV=1 106 508 2.0E-170
sp|Q7VMA9|ISCS_HAEDU Cysteine desulfurase IscS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=iscS PE=3 SV=1 108 508 4.0E-170
sp|A1SUI4|ISCS_PSYIN Cysteine desulfurase IscS OS=Psychromonas ingrahamii (strain 37) GN=iscS PE=3 SV=1 108 507 8.0E-170
sp|Q9JYY0|ISCS_NEIMB Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup B (strain MC58) GN=iscS PE=3 SV=1 106 508 1.0E-169
sp|B7UWH7|ISCS_PSEA8 Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain LESB58) GN=iscS PE=3 SV=1 108 508 7.0E-168
sp|A5CWM6|ISCS_VESOH Cysteine desulfurase IscS OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=iscS PE=3 SV=1 108 508 3.0E-167
sp|Q9HXI8|ISCS_PSEAE Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=iscS PE=3 SV=1 108 508 3.0E-167
sp|Q02RW8|ISCS_PSEAB Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=iscS PE=3 SV=1 108 508 3.0E-167
sp|B0VD51|ISCS_ACIBY Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AYE) GN=iscS PE=3 SV=1 106 508 3.0E-167
sp|B2HZI5|ISCS_ACIBC Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain ACICU) GN=iscS PE=3 SV=1 106 508 3.0E-167
sp|B7I5Q3|ISCS_ACIB5 Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AB0057) GN=iscS PE=3 SV=1 106 508 3.0E-167
sp|B7H3H0|ISCS_ACIB3 Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AB307-0294) GN=iscS PE=3 SV=1 106 508 3.0E-167
sp|Q60C64|ISCS_METCA Cysteine desulfurase IscS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=iscS PE=3 SV=1 108 506 4.0E-167
sp|B0VNW2|ISCS_ACIBS Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain SDF) GN=iscS PE=3 SV=1 106 508 4.0E-167
sp|A4VNY2|ISCS_PSEU5 Cysteine desulfurase IscS OS=Pseudomonas stutzeri (strain A1501) GN=iscS PE=3 SV=1 108 508 2.0E-166
sp|A6V0U8|ISCS_PSEA7 Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain PA7) GN=iscS PE=3 SV=1 108 508 2.0E-166
sp|C5BEU5|ISCS_EDWI9 Cysteine desulfurase IscS OS=Edwardsiella ictaluri (strain 93-146) GN=iscS PE=3 SV=1 108 508 8.0E-166
sp|Q887A1|ISCS_PSESM Cysteine desulfurase IscS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=iscS PE=3 SV=1 108 508 4.0E-164
sp|B1JDR3|ISCS_PSEPW Cysteine desulfurase IscS OS=Pseudomonas putida (strain W619) GN=iscS PE=3 SV=1 108 508 1.0E-163
sp|Q4ZX34|ISCS_PSEU2 Cysteine desulfurase IscS OS=Pseudomonas syringae pv. syringae (strain B728a) GN=iscS PE=3 SV=1 108 508 2.0E-163
sp|Q48M05|ISCS_PSE14 Cysteine desulfurase IscS OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=iscS PE=3 SV=1 108 508 2.0E-163
sp|Q1IEJ2|ISCS_PSEE4 Cysteine desulfurase IscS OS=Pseudomonas entomophila (strain L48) GN=iscS PE=3 SV=1 108 508 2.0E-163
sp|A4XY43|ISCS_PSEMY Cysteine desulfurase IscS OS=Pseudomonas mendocina (strain ymp) GN=iscS PE=3 SV=1 108 508 3.0E-163
sp|Q88PK8|ISCS_PSEPK Cysteine desulfurase IscS OS=Pseudomonas putida (strain KT2440) GN=iscS PE=3 SV=1 108 508 8.0E-163
sp|A5VYS4|ISCS_PSEP1 Cysteine desulfurase IscS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=iscS PE=3 SV=1 108 508 8.0E-163
sp|B0KPH6|ISCS_PSEPG Cysteine desulfurase IscS OS=Pseudomonas putida (strain GB-1) GN=iscS PE=3 SV=1 108 508 1.0E-162
sp|B8D8B6|ISCS_BUCAT Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=iscS PE=3 SV=1 106 507 2.0E-162
sp|P57657|ISCS_BUCAI Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscS PE=3 SV=1 106 507 2.0E-162
sp|B8D8F9|ISCS_BUCA5 Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=iscS PE=3 SV=1 106 507 2.0E-162
sp|C1DE68|ISCS_AZOVD Cysteine desulfurase IscS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=iscS PE=3 SV=1 108 508 6.0E-162
sp|A1AWM1|ISCS_RUTMC Cysteine desulfurase IscS OS=Ruthia magnifica subsp. Calyptogena magnifica GN=iscS PE=3 SV=1 108 508 2.0E-161
sp|O31269|ISCS_AZOVI Cysteine desulfurase IscS OS=Azotobacter vinelandii GN=iscS PE=1 SV=3 108 508 3.0E-161
sp|Q4K6T8|ISCS_PSEF5 Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=iscS PE=3 SV=1 108 508 2.0E-160
sp|Q3K7A5|ISCS_PSEPF Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain Pf0-1) GN=iscS PE=3 SV=1 108 508 3.0E-160
sp|C3K1M5|ISCS_PSEFS Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain SBW25) GN=iscS PE=3 SV=1 108 508 2.0E-159
sp|Q2INI7|ISCS_ANADE Cysteine desulfurase IscS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=iscS PE=3 SV=1 108 507 2.0E-159
sp|B4UCP2|ISCS_ANASK Cysteine desulfurase IscS OS=Anaeromyxobacter sp. (strain K) GN=iscS PE=3 SV=1 108 507 3.0E-159
sp|B8JC53|ISCS_ANAD2 Cysteine desulfurase IscS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=iscS PE=3 SV=1 108 507 7.0E-159
sp|A7H804|ISCS_ANADF Cysteine desulfurase IscS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=iscS PE=3 SV=1 108 507 3.0E-154
sp|O51886|ISCS_BUCAP Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=iscS PE=3 SV=1 106 507 9.0E-152
sp|B2VI32|ISCS_ERWT9 Cysteine desulfurase IscS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=iscS PE=3 SV=1 108 497 1.0E-151
sp|Q89A19|ISCS_BUCBP Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=iscS PE=3 SV=1 108 508 4.0E-149
sp|P57795|ISCS_METTE Cysteine desulfurase IscS OS=Methanosarcina thermophila GN=iscS PE=3 SV=1 106 490 3.0E-117
sp|Q43884|NIFS_TRIAZ Cysteine desulfurase OS=Trichormus azollae GN=nifS PE=3 SV=1 109 496 3.0E-111
sp|Q44507|NIFS1_ANAVT Cysteine desulfurase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifS1 PE=3 SV=2 109 496 3.0E-111
sp|A5I4Z9|ISCS_CLOBH Cysteine desulfurase IscS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=iscS PE=3 SV=1 106 492 3.0E-111
sp|A7FWJ9|ISCS_CLOB1 Cysteine desulfurase IscS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=iscS PE=3 SV=1 106 492 3.0E-111
sp|P12623|NIFS_NOSS1 Cysteine desulfurase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifS PE=3 SV=3 109 496 5.0E-111
sp|C1FTC4|ISCS_CLOBJ Cysteine desulfurase IscS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=iscS PE=3 SV=1 106 492 1.0E-110
sp|Q44482|NIFS2_ANAVT Cysteine desulfurase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifS2 PE=3 SV=2 109 490 2.0E-109
sp|B8DZS1|ISCS_DICTD Cysteine desulfurase IscS OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=iscS PE=3 SV=1 106 493 3.0E-108
sp|O54055|ISCS_RUMFL Cysteine desulfurase IscS OS=Ruminococcus flavefaciens GN=iscS PE=1 SV=1 106 497 3.0E-107
sp|O30052|ISCS1_ARCFU Cysteine desulfurase IscS 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscS1 PE=3 SV=2 110 491 2.0E-101
sp|O29689|ISCS2_ARCFU Cysteine desulfurase IscS 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscS2 PE=1 SV=1 110 491 2.0E-101
sp|P05341|NIFS_AZOVI Cysteine desulfurase NifS OS=Azotobacter vinelandii GN=nifS PE=1 SV=4 109 491 4.0E-96
sp|B2US50|ISCS_HELPS Cysteine desulfurase IscS OS=Helicobacter pylori (strain Shi470) GN=iscS PE=3 SV=1 109 488 7.0E-96
sp|Q52069|NIFS_ENTAG Cysteine desulfurase OS=Enterobacter agglomerans GN=nifS PE=3 SV=1 107 492 7.0E-95
sp|Q9ZML2|ISCS_HELPJ Cysteine desulfurase IscS OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=iscS PE=3 SV=1 109 488 7.0E-95
sp|O25008|ISCS_HELPY Cysteine desulfurase IscS OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=iscS PE=1 SV=1 109 488 4.0E-94
sp|B6JKF2|ISCS_HELP2 Cysteine desulfurase IscS OS=Helicobacter pylori (strain P12) GN=iscS PE=3 SV=1 109 488 4.0E-94
sp|P57794|NIFS_GLUDA Cysteine desulfurase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nifS PE=3 SV=1 109 492 3.0E-92
sp|O34599|ISCS1_BACSU Putative cysteine desulfurase IscS 1 OS=Bacillus subtilis (strain 168) GN=iscS1 PE=3 SV=2 109 484 8.0E-92
sp|P05344|NIFS_KLEPN Cysteine desulfurase OS=Klebsiella pneumoniae GN=nifS PE=3 SV=2 109 492 9.0E-88
sp|P37030|NIFS_BRADU Cysteine desulfurase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nifS PE=3 SV=2 102 485 7.0E-83
sp|P55690|NIFS_RHISN Cysteine desulfurase OS=Rhizobium sp. (strain NGR234) GN=nifS PE=3 SV=1 107 491 8.0E-83
sp|P23120|NIFS_AZOCH Cysteine desulfurase OS=Azotobacter chroococcum mcd 1 GN=nifS PE=3 SV=3 109 491 8.0E-81
sp|Q01179|NIFS_RHOSH Cysteine desulfurase OS=Rhodobacter sphaeroides GN=nifS PE=3 SV=1 109 490 2.0E-79
sp|Q07177|NIFS_RHOCA Cysteine desulfurase OS=Rhodobacter capsulatus GN=nifS PE=3 SV=1 106 490 2.0E-72
sp|Q9Z5X5|NIFS_FRASE Cysteine desulfurase OS=Frankia sp. (strain EuIK1) GN=nifS PE=3 SV=1 109 496 1.0E-71
sp|P70727|NIFS_AZOBR Cysteine desulfurase OS=Azospirillum brasilense GN=nifS PE=3 SV=1 109 498 2.0E-70
sp|O34874|ISCS2_BACSU Putative cysteine desulfurase IscS 2 OS=Bacillus subtilis (strain 168) GN=iscS2 PE=3 SV=1 109 487 6.0E-69
sp|P9WQ71|ISCSL_MYCTU IscS-like cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=iscS PE=1 SV=1 110 475 1.0E-67
sp|P9WQ70|ISCSL_MYCTO Iscs-like cysteine desulfurase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=iscS PE=3 SV=1 110 475 1.0E-67
sp|A2VDS1|SCLY_BOVIN Selenocysteine lyase OS=Bos taurus GN=SCLY PE=2 SV=1 107 484 1.0E-65
sp|Q68FT9|SCLY_RAT Selenocysteine lyase OS=Rattus norvegicus GN=Scly PE=1 SV=1 106 484 5.0E-63
sp|P31672|NIFS_LACDA NifS/IcsS protein homolog OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=Ldb0724 PE=3 SV=2 109 492 1.0E-62
sp|Q96I15|SCLY_HUMAN Selenocysteine lyase OS=Homo sapiens GN=SCLY PE=1 SV=4 106 486 3.0E-62
sp|P38033|NIFS_BACSU Putative cysteine desulfurase NifS OS=Bacillus subtilis (strain 168) GN=nifS PE=2 SV=1 109 501 3.0E-62
sp|Q9JLI6|SCLY_MOUSE Selenocysteine lyase OS=Mus musculus GN=Scly PE=1 SV=1 107 484 3.0E-61
sp|Q5U4Q9|SCLY_XENTR Selenocysteine lyase OS=Xenopus tropicalis GN=scly PE=2 SV=2 109 484 2.0E-58
sp|Q66IQ6|SCLY_XENLA Selenocysteine lyase OS=Xenopus laevis GN=scly PE=2 SV=1 109 484 7.0E-55
sp|Q9KDJ6|NIFS_BACHD Putative cysteine desulfurase NifS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nifS PE=3 SV=1 109 481 2.0E-54
sp|D4GYV5|SUFS_HALVD Cysteine desulfurase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=sufS PE=1 SV=1 109 433 9.0E-33
sp|Q9HMM6|CSD_HALSA Probable cysteine desulfurase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=csd PE=3 SV=1 105 337 1.0E-31
sp|Q9K7A0|CSD_BACHD Probable cysteine desulfurase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=csd PE=3 SV=2 105 337 3.0E-30
sp|Q9YAB6|CSD_AERPE Probable cysteine desulfurase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=csd PE=3 SV=1 109 432 2.0E-29
sp|Q9V242|CSD_PYRAB Probable cysteine desulfurase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=csd PE=3 SV=1 106 338 1.0E-28
sp|A7FHJ2|SUFS_YERP3 Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sufS PE=3 SV=1 105 337 5.0E-28
sp|Q5HQQ0|CSD_STAEQ Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=csd PE=3 SV=1 95 484 5.0E-28
sp|Q8CTA4|CSD_STAES Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=csd PE=3 SV=1 95 484 6.0E-28
sp|O32164|SUFS_BACSU Cysteine desulfurase SufS OS=Bacillus subtilis (strain 168) GN=sufS PE=1 SV=1 105 337 7.0E-28
sp|Q8NXH0|CSD_STAAW Probable cysteine desulfurase OS=Staphylococcus aureus (strain MW2) GN=csd PE=3 SV=1 94 337 8.0E-28
sp|Q6GB11|CSD_STAAS Probable cysteine desulfurase OS=Staphylococcus aureus (strain MSSA476) GN=csd PE=3 SV=1 94 337 8.0E-28
sp|Q6GIH2|CSD_STAAR Probable cysteine desulfurase OS=Staphylococcus aureus (strain MRSA252) GN=csd PE=3 SV=1 94 337 8.0E-28
sp|P99177|CSD_STAAN Probable cysteine desulfurase OS=Staphylococcus aureus (strain N315) GN=csd PE=1 SV=1 94 337 8.0E-28
sp|P63518|CSD_STAAM Probable cysteine desulfurase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=csd PE=3 SV=1 94 337 8.0E-28
sp|Q5HHH0|CSD_STAAC Probable cysteine desulfurase OS=Staphylococcus aureus (strain COL) GN=csd PE=3 SV=1 94 337 8.0E-28
sp|P57989|CSD_PASMU Probable cysteine desulfurase OS=Pasteurella multocida (strain Pm70) GN=csd PE=3 SV=1 102 484 1.0E-27
sp|Q66A22|SUFS_YERPS Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sufS PE=3 SV=1 105 337 1.0E-27
sp|B2K5J4|SUFS_YERPB Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sufS PE=3 SV=1 105 337 1.0E-27
sp|Q9XAD5|CSD_STRCO Probable cysteine desulfurase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=csd PE=3 SV=1 102 350 2.0E-27
sp|B1JJ48|SUFS_YERPY Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sufS PE=3 SV=1 105 337 3.0E-27
sp|A4TIP2|SUFS_YERPP Cysteine desulfurase OS=Yersinia pestis (strain Pestoides F) GN=sufS PE=3 SV=1 105 337 3.0E-27
sp|Q1CIJ6|SUFS_YERPN Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sufS PE=3 SV=1 105 337 3.0E-27
sp|Q8D0M6|SUFS_YERPE Cysteine desulfurase OS=Yersinia pestis GN=sufS PE=3 SV=2 105 337 3.0E-27
sp|Q1C761|SUFS_YERPA Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sufS PE=3 SV=1 105 337 3.0E-27
sp|A9QZC9|SUFS_YERPG Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sufS PE=3 SV=1 105 337 6.0E-27
sp|A8GDU4|SUFS_SERP5 Cysteine desulfurase OS=Serratia proteamaculans (strain 568) GN=sufS PE=3 SV=1 105 347 6.0E-27
sp|O27442|CSD_METTH Probable cysteine desulfurase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=csd PE=3 SV=1 109 479 9.0E-27
sp|Q9HXX3|CSD_PSEAE Probable cysteine desulfurase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=csd PE=3 SV=1 110 485 6.0E-26
sp|Q9PQ36|CSD_UREPA Probable cysteine desulfurase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=csd PE=3 SV=1 102 338 7.0E-26
sp|Q9Z7L5|CSD_CHLPN Probable cysteine desulfurase OS=Chlamydia pneumoniae GN=csd PE=3 SV=1 99 485 1.0E-25
sp|Q9KII6|CSD_MYCPA Probable cysteine desulfurase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_2120c PE=3 SV=1 105 478 2.0E-24
sp|Q93WX6|CNIF1_ARATH Cysteine desulfurase 1, chloroplastic OS=Arabidopsis thaliana GN=NFS2 PE=1 SV=1 105 487 3.0E-24
sp|Q6D625|SUFS_PECAS Cysteine desulfurase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sufS PE=3 SV=1 105 346 4.0E-24
sp|P9WQ69|CSD_MYCTU Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=csd PE=1 SV=1 95 337 5.0E-24
sp|P9WQ68|CSD_MYCTO Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=csd PE=3 SV=1 95 337 5.0E-24
sp|P63517|CSD_MYCBO Probable cysteine desulfurase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=csd PE=3 SV=1 95 337 5.0E-24
sp|Q49690|CSD2_MYCLE Probable cysteine desulfurase 2 OS=Mycobacterium leprae (strain TN) GN=csd2 PE=3 SV=1 95 350 5.0E-24
sp|Q9EXP2|SUFS_DICD3 Cysteine desulfurase OS=Dickeya dadantii (strain 3937) GN=sufS PE=1 SV=1 95 347 1.0E-23
sp|Q9KPQ7|CSD_VIBCH Probable cysteine desulfurase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=csd PE=3 SV=1 105 337 2.0E-23
sp|O84693|CSD_CHLTR Probable cysteine desulfurase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=csd PE=3 SV=1 104 337 2.0E-23
sp|O51111|CSD_BORBU Probable cysteine desulfurase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=csd PE=3 SV=1 104 338 2.0E-23
sp|Q9PLP0|CSD_CHLMU Probable cysteine desulfurase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=csd PE=3 SV=1 109 445 7.0E-23
sp|C6DKM6|SUFS_PECCP Cysteine desulfurase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=sufS PE=3 SV=1 105 347 9.0E-23
sp|Q7N3U5|SUFS_PHOLL Cysteine desulfurase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sufS PE=3 SV=1 105 351 3.0E-22
sp|A4W9R3|SUFS_ENT38 Cysteine desulfurase OS=Enterobacter sp. (strain 638) GN=sufS PE=3 SV=1 110 337 4.0E-22
sp|B5F7C4|SUFS_SALA4 Cysteine desulfurase OS=Salmonella agona (strain SL483) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|Q7CQN5|SUFS_SALTY Cysteine desulfurase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|Q8XF77|SUFS_SALTI Cysteine desulfurase OS=Salmonella typhi GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|B4T4R6|SUFS_SALNS Cysteine desulfurase OS=Salmonella newport (strain SL254) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|B4TGK9|SUFS_SALHS Cysteine desulfurase OS=Salmonella heidelberg (strain SL476) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|B5RAT4|SUFS_SALG2 Cysteine desulfurase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|B5QVS9|SUFS_SALEP Cysteine desulfurase OS=Salmonella enteritidis PT4 (strain P125109) GN=sufS PE=3 SV=1 110 337 6.0E-22
sp|A9N142|SUFS_SALPB Cysteine desulfurase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sufS PE=3 SV=1 110 337 9.0E-22
sp|B4TUT5|SUFS_SALSV Cysteine desulfurase OS=Salmonella schwarzengrund (strain CVM19633) GN=sufS PE=3 SV=1 110 337 1.0E-21
sp|Q57PR2|SUFS_SALCH Cysteine desulfurase OS=Salmonella choleraesuis (strain SC-B67) GN=sufS PE=3 SV=1 110 337 1.0E-21
sp|B5FIM3|SUFS_SALDC Cysteine desulfurase OS=Salmonella dublin (strain CT_02021853) GN=sufS PE=3 SV=1 110 337 1.0E-21
sp|Q55793|CSD_SYNY3 Probable cysteine desulfurase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=csd PE=1 SV=1 105 486 2.0E-21
sp|A6TAE4|SUFS_KLEP7 Cysteine desulfurase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sufS PE=3 SV=1 104 337 2.0E-21
sp|Q3Z233|SUFS_SHISS Cysteine desulfurase OS=Shigella sonnei (strain Ss046) GN=sufS PE=3 SV=1 110 337 2.0E-21
sp|O32975|CSD1_MYCLE Probable cysteine desulfurase 1 OS=Mycobacterium leprae (strain TN) GN=csd1 PE=3 SV=1 105 478 3.0E-21
sp|Q7UAH4|SUFS_SHIFL Cysteine desulfurase OS=Shigella flexneri GN=sufS PE=3 SV=1 110 337 5.0E-21
sp|B6IBB9|SUFS_ECOSE Cysteine desulfurase OS=Escherichia coli (strain SE11) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7N516|SUFS_ECOLU Cysteine desulfurase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|P77444|SUFS_ECOLI Cysteine desulfurase OS=Escherichia coli (strain K12) GN=sufS PE=1 SV=1 110 337 6.0E-21
sp|B1XFY8|SUFS_ECODH Cysteine desulfurase OS=Escherichia coli (strain K12 / DH10B) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|C4ZYE2|SUFS_ECOBW Cysteine desulfurase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|Q1RBB6|SUFS_ECOUT Cysteine desulfurase OS=Escherichia coli (strain UTI89 / UPEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|A1ABL8|SUFS_ECOK1 Cysteine desulfurase OS=Escherichia coli O1:K1 / APEC GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7MV59|SUFS_ECO81 Cysteine desulfurase OS=Escherichia coli O81 (strain ED1a) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7L5N2|SUFS_ECO55 Cysteine desulfurase OS=Escherichia coli (strain 55989 / EAEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7MA32|SUFS_ECO45 Cysteine desulfurase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|Q8FH54|SUFS_ECOL6 Cysteine desulfurase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7US19|SUFS_ECO27 Cysteine desulfurase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B5Z4B3|SUFS_ECO5E Cysteine desulfurase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|Q7ADI4|SUFS_ECO57 Cysteine desulfurase OS=Escherichia coli O157:H7 GN=sufS PE=3 SV=1 110 337 6.0E-21
sp|B7LQ96|SUFS_ESCF3 Cysteine desulfurase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sufS PE=3 SV=1 110 337 7.0E-21
sp|Q0THE9|SUFS_ECOL5 Cysteine desulfurase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sufS PE=3 SV=1 110 337 1.0E-20
sp|A9MEP3|SUFS_SALAR Cysteine desulfurase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=sufS PE=3 SV=1 110 337 1.0E-20
sp|Q9Z408|CSD_PSEPK Probable cysteine desulfurase OS=Pseudomonas putida (strain KT2440) GN=csdA PE=3 SV=1 106 485 1.0E-20
sp|Q321D9|SUFS_SHIBS Cysteine desulfurase OS=Shigella boydii serotype 4 (strain Sb227) GN=sufS PE=3 SV=1 110 337 1.0E-20
sp|B2U2I4|SUFS_SHIB3 Cysteine desulfurase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sufS PE=3 SV=1 110 337 1.0E-20
sp|B1LE56|SUFS_ECOSM Cysteine desulfurase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sufS PE=3 SV=1 110 337 2.0E-20
sp|B7NTV6|SUFS_ECO7I Cysteine desulfurase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sufS PE=3 SV=1 110 337 2.0E-20
sp|B7M0N5|SUFS_ECO8A Cysteine desulfurase OS=Escherichia coli O8 (strain IAI1) GN=sufS PE=3 SV=1 110 337 2.0E-20
sp|B5XQH2|SUFS_KLEP3 Cysteine desulfurase OS=Klebsiella pneumoniae (strain 342) GN=sufS PE=3 SV=1 104 337 2.0E-20
sp|Q57476|CSD_HAEIN Probable cysteine desulfurase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=csd PE=3 SV=1 109 337 7.0E-20
sp|A7ZME5|SUFS_ECO24 Cysteine desulfurase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sufS PE=3 SV=1 110 337 1.0E-19
sp|A8A0M6|SUFS_ECOHS Cysteine desulfurase OS=Escherichia coli O9:H4 (strain HS) GN=sufS PE=3 SV=1 110 337 1.0E-19
sp|Q9PDA6|CSD_XYLFA Probable cysteine desulfurase OS=Xylella fastidiosa (strain 9a5c) GN=csd PE=3 SV=1 104 438 2.0E-19
sp|A8AH80|SUFS_CITK8 Cysteine desulfurase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sufS PE=3 SV=1 110 337 3.0E-19
sp|Q46925|CSDA_ECOLI Cysteine desulfurase CsdA OS=Escherichia coli (strain K12) GN=csdA PE=1 SV=1 109 337 4.0E-19
sp|B1IQ76|SUFS_ECOLC Cysteine desulfurase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sufS PE=3 SV=1 110 337 6.0E-19
sp|A7MF59|SUFS_CROS8 Cysteine desulfurase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=sufS PE=3 SV=1 105 337 1.0E-18
sp|Q49420|CSD_MYCGE Probable cysteine desulfurase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=csd PE=3 SV=1 97 382 2.0E-18
sp|Q87DJ2|CSD_XYLFT Probable cysteine desulfurase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=csd PE=3 SV=1 104 438 1.0E-17
sp|Q8D2J7|SUFS_WIGBR Cysteine desulfurase OS=Wigglesworthia glossinidia brevipalpis GN=sufS PE=3 SV=1 91 488 2.0E-17
sp|P75298|CSD_MYCPN Probable cysteine desulfurase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=csd PE=3 SV=1 97 337 1.0E-16
sp|Q9X191|CSD_THEMA Probable cysteine desulfurase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=csd PE=3 SV=1 105 337 9.0E-16
sp|P71379|Y1343_HAEIN Putative csd-like protein HI_1343 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1343 PE=5 SV=1 222 337 4.0E-13
sp|O83623|CSD_TREPA Probable cysteine desulfurase OS=Treponema pallidum (strain Nichols) GN=csd PE=3 SV=1 107 338 6.0E-12
sp|P42253|YCBU_BACSU Uncharacterized aminotransferase YcbU OS=Bacillus subtilis (strain 168) GN=ycbU PE=3 SV=3 147 343 3.0E-11
sp|Q10089|YAOA_SCHPO Uncharacterized protein C11D3.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.10 PE=3 SV=1 101 338 8.0E-11
sp|A0R5M7|EGTE_MYCS2 Probable hercynylcysteine sulfoxide lyase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtE PE=3 SV=1 152 334 7.0E-10
sp|O74542|YCV3_SCHPO Uncharacterized aminotransferase C777.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.03c PE=3 SV=1 97 349 1.0E-09
sp|Q54RV9|SGPL_DICDI Sphingosine-1-phosphate lyase OS=Dictyostelium discoideum GN=sglA PE=2 SV=1 155 409 3.0E-09
sp|O69668|EGTE_MYCTU Probable hercynylcysteine sulfoxide lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtE PE=1 SV=3 153 330 4.0E-09
sp|Q5WKB5|KYNU_BACSK Kynureninase OS=Bacillus clausii (strain KSM-K16) GN=kynU PE=3 SV=1 89 355 3.0E-07
sp|Q9N0E7|MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus GN=MOCOS PE=2 SV=3 109 338 1.0E-06
sp|P0C9C9|NIFSL_ASFP4 NifS-like protein OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-136 PE=3 SV=1 158 479 1.0E-06
sp|P0C9D0|NIFSL_ASFWA NifS-like protein OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-134 PE=3 SV=1 158 479 2.0E-06
sp|P9WQ67|Y3778_MYCTU Uncharacterized protein Rv3778c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3778c PE=1 SV=1 149 477 2.0E-06
sp|P9WQ66|Y3778_MYCTO Uncharacterized protein MT3887 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3887 PE=3 SV=1 149 477 2.0E-06
sp|Q65236|NIFSL_ASFM2 NifS-like protein OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-132 PE=3 SV=1 146 479 2.0E-06
sp|Q65192|NIFSL_ASFB7 NifS-like protein OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-124 PE=3 SV=1 158 479 3.0E-06
sp|P0C9D1|NIFSL_ASFK5 NifS-like protein OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-136 PE=3 SV=1 146 498 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5388
MATLASCALRSARAGTTGAALPRLSLSLSRTPCAISAISAIEAPSRRHTYVTQSRRDNAKVETAIKLDKKDFVDI
PPPQLGPSASGATVSPMAEVLKQAAVMEEGQRPIYLDMQSTTPVDPRVLDAMLPYYVGVYGNPHSRTHAYGWESE
KAVEEAREHVARLIGADSKEIIFTSGATESNNMSIKGVARFFGRSGKKKHIITTQTEHKCVLDSCRHLQDEGFEV
TYLPVQNNGLVRMSDLEAAIRPETALVSIMTVNNEIGVIQPITQIGKLCRDKKVFFHTDAAQAVGKIPLDVNAMN
IDLMSISSHKIYGPKGIGACYVRRRPRVRLDPIISGGGQERGLRSGTLAPPLLAGFGEACRIAAQEMEYDSKRIK
FLSDRLLQGLLSLEHTVQNGDPNSFYPGCVNVSFAYVEGESLLMALKDIALSSGSACTSASLEPSYVLRALGNSD
ESAHSSIRFGIGRFTTEMEIDYVLKAVQERVSFLRELSPLWELVQEGIDLNTIQWSQH*
Coding >OphauB2|5388
ATGGCCACGCTTGCATCCTGCGCGCTGAGGTCGGCTCGTGCAGGCACCACAGGCGCCGCTTTGCCACGACTATCC
CTTTCCCTATCTCGTACTCCATGCGCCATCAGCGCCATCAGCGCCATCGAGGCGCCTTCGAGACGGCACACATAC
GTCACCCAGTCGAGACGCGATAATGCAAAGGTCGAGACTGCCATCAAGCTCGACAAGAAGGACTTTGTTGATATC
CCGCCCCCTCAACTGGGACCCTCTGCTTCGGGAGCCACTGTGAGCCCCATGGCCGAGGTTCTTAAACAAGCCGCC
GTCATGGAAGAAGGCCAGCGGCCCATATATCTAGACATGCAATCCACCACACCCGTCGACCCCAGAGTACTGGAT
GCCATGCTGCCCTACTATGTGGGCGTCTACGGCAACCCACATTCGCGCACCCATGCCTATGGCTGGGAGAGTGAA
AAGGCTGTTGAAGAGGCTCGCGAGCATGTTGCCCGCCTTATTGGCGCCGACTCAAAGGAAATCATCTTCACTAGT
GGTGCCACCGAGAGCAACAATATGAGCATCAAGGGCGTCGCCCGTTTTTTTGGCCGCTCCGGCAAGAAGAAGCAC
ATCATCACTACACAAACGGAGCACAAGTGCGTTCTCGATAGCTGTCGCCACCTGCAGGACGAGGGCTTTGAAGTT
ACATATCTGCCTGTCCAAAACAACGGCCTGGTGCGCATGTCCGACCTTGAAGCTGCCATACGCCCCGAGACGGCC
CTCGTCAGCATCATGACTGTCAATAATGAGATTGGCGTCATCCAACCCATTACGCAAATTGGAAAGCTGTGTCGC
GACAAGAAGGTTTTTTTCCACACCGACGCTGCCCAGGCTGTGGGCAAGATTCCACTCGACGTCAATGCCATGAAT
ATTGATCTCATGTCCATATCGTCACACAAGATTTATGGGCCCAAGGGTATTGGCGCCTGTTACGTTCGGAGACGG
CCCAGAGTCCGTTTAGATCCCATCATAAGTGGTGGCGGACAGGAGCGGGGATTGCGTAGCGGTACGCTTGCGCCG
CCGCTGCTCGCTGGCTTTGGCGAGGCTTGCCGCATCGCCGCCCAAGAGATGGAGTACGATTCGAAGCGAATCAAG
TTCCTCTCTGACAGATTGCTCCAGGGTCTTTTGAGCTTGGAGCACACTGTCCAAAATGGCGATCCCAATTCCTTT
TATCCCGGCTGCGTCAATGTTTCATTTGCCTACGTCGAGGGCGAATCGCTCCTCATGGCCCTCAAAGACATTGCG
CTATCGTCGGGCAGCGCATGCACATCTGCCTCGCTCGAACCCAGCTACGTCTTGCGGGCGCTAGGCAACAGTGAC
GAGAGCGCTCACAGCAGTATCCGCTTTGGCATTGGACGGTTTACGACGGAAATGGAGATTGATTACGTCCTCAAG
GCGGTGCAGGAACGTGTCAGCTTTTTGCGCGAGCTGAGCCCGCTCTGGGAGTTGGTCCAGGAAGGGATTGACCTC
AACACAATTCAATGGAGCCAGCATTAG
Transcript >OphauB2|5388
ATGGCCACGCTTGCATCCTGCGCGCTGAGGTCGGCTCGTGCAGGCACCACAGGCGCCGCTTTGCCACGACTATCC
CTTTCCCTATCTCGTACTCCATGCGCCATCAGCGCCATCAGCGCCATCGAGGCGCCTTCGAGACGGCACACATAC
GTCACCCAGTCGAGACGCGATAATGCAAAGGTCGAGACTGCCATCAAGCTCGACAAGAAGGACTTTGTTGATATC
CCGCCCCCTCAACTGGGACCCTCTGCTTCGGGAGCCACTGTGAGCCCCATGGCCGAGGTTCTTAAACAAGCCGCC
GTCATGGAAGAAGGCCAGCGGCCCATATATCTAGACATGCAATCCACCACACCCGTCGACCCCAGAGTACTGGAT
GCCATGCTGCCCTACTATGTGGGCGTCTACGGCAACCCACATTCGCGCACCCATGCCTATGGCTGGGAGAGTGAA
AAGGCTGTTGAAGAGGCTCGCGAGCATGTTGCCCGCCTTATTGGCGCCGACTCAAAGGAAATCATCTTCACTAGT
GGTGCCACCGAGAGCAACAATATGAGCATCAAGGGCGTCGCCCGTTTTTTTGGCCGCTCCGGCAAGAAGAAGCAC
ATCATCACTACACAAACGGAGCACAAGTGCGTTCTCGATAGCTGTCGCCACCTGCAGGACGAGGGCTTTGAAGTT
ACATATCTGCCTGTCCAAAACAACGGCCTGGTGCGCATGTCCGACCTTGAAGCTGCCATACGCCCCGAGACGGCC
CTCGTCAGCATCATGACTGTCAATAATGAGATTGGCGTCATCCAACCCATTACGCAAATTGGAAAGCTGTGTCGC
GACAAGAAGGTTTTTTTCCACACCGACGCTGCCCAGGCTGTGGGCAAGATTCCACTCGACGTCAATGCCATGAAT
ATTGATCTCATGTCCATATCGTCACACAAGATTTATGGGCCCAAGGGTATTGGCGCCTGTTACGTTCGGAGACGG
CCCAGAGTCCGTTTAGATCCCATCATAAGTGGTGGCGGACAGGAGCGGGGATTGCGTAGCGGTACGCTTGCGCCG
CCGCTGCTCGCTGGCTTTGGCGAGGCTTGCCGCATCGCCGCCCAAGAGATGGAGTACGATTCGAAGCGAATCAAG
TTCCTCTCTGACAGATTGCTCCAGGGTCTTTTGAGCTTGGAGCACACTGTCCAAAATGGCGATCCCAATTCCTTT
TATCCCGGCTGCGTCAATGTTTCATTTGCCTACGTCGAGGGCGAATCGCTCCTCATGGCCCTCAAAGACATTGCG
CTATCGTCGGGCAGCGCATGCACATCTGCCTCGCTCGAACCCAGCTACGTCTTGCGGGCGCTAGGCAACAGTGAC
GAGAGCGCTCACAGCAGTATCCGCTTTGGCATTGGACGGTTTACGACGGAAATGGAGATTGATTACGTCCTCAAG
GCGGTGCAGGAACGTGTCAGCTTTTTGCGCGAGCTGAGCCCGCTCTGGGAGTTGGTCCAGGAAGGGATTGACCTC
AACACAATTCAATGGAGCCAGCATTAG
Gene >OphauB2|5388
ATGGCCACGCTTGCATCCTGCGCGCTGAGGTCGGCTCGTGCAGGCACCACAGGCGCCGCTTTGCCACGACTATCC
CTTTCCCTATCTCGTACTCCATGCGCCATCAGCGCCATCAGCGCCATCGAGGCGCCTTCGAGACGGCACACATAC
GTCACCCAGTCGAGACGCGATAATGCAAAGGTCGAGACTGCCATCAAGCTCGACAAGAAGGACTTTGTTGATATC
CCGCCCCCTCAACTGGGACCCTCTGCTTCGGGAGCCACTGTGAGCCCCATGGCCGGTCAGCCTTTTCTCTTTTCC
CCTCTTCTGTATATTGGCTCATTGCAACCTTTTAGAGGTTCTTAAACAAGCCGCCGTCATGGAAGAAGGCCAGCG
GCCCATATATCTAGACATGCAATCCACCACACCCGTCGACCCCAGAGTACTGGATGCCATGCTGCCCTACTATGT
GGGCGTCTACGGCAACCCACATTCGCGCACCCATGCCTATGGCTGGGAGAGTGAAAAGGCTGTTGAAGAGGCTCG
CGAGCATGTTGCCCGCCTTATTGGCGCCGACTCAAAGGAAATCATCTTCACTAGTGGTGCCACCGAGAGCAACAA
TATGAGCATCAAGGGCGTCGCCCGTTTTTTTGGCCGCTCCGGCAAGAAGAAGCACATCATCACTACACAAACGGA
GCACAAGTGCGTTCTCGATAGCTGTCGCCACCTGCAGGACGAGGGCTTTGAAGTTACATATCTGCCTGTCCAAAA
CAACGGCCTGGTGCGCATGTCCGACCTTGAAGCTGCCATACGCCCCGAGACGGCCCTCGTCAGCATCATGACTGT
CAATAATGAGATTGGCGTCATCCAACCCATTACGCAAATTGGAAAGCTGTGTCGCGACAAGAAGGTTTTTTTCCA
CACCGACGCTGCCCAGGCTGTGGGCAAGATTCCACTCGACGTCAATGCCATGAATATTGATCTCATGTCCATATC
GTCACACAAGATTTATGGGCCCAAGGGTATTGGCGCCTGTTACGTTCGGAGACGGCCCAGAGTCCGTTTAGATCC
CATCATAAGTGGTGGCGGACAGGAGCGGGGATTGCGTAGCGGTACGCTTGCGCCGCCGCTGCTCGCTGGCTTTGG
CGAGGCTTGCCGCATCGCCGCCCAAGAGATGGAGGTAGGCATACCCTTGAGGGGTTTTTCTTGTTTCGCTTCTTG
TTTCACCATGGCGGCTGACAAGAAACATGCAGTACGATTCGAAGCGAATCAAGTTCCTCTCTGACAGATTGCTCC
AGGGTCTTTTGAGCTTGGAGCACACTGTCCAAAATGGCGATCCCAATTCCTTTTATCCCGGCTGCGTCAATGTTT
CATTTGCCTACGTCGAGGGCGAATCGCTCCTCATGGCCCTCAAAGACATTGCGCTATCGTCGGGCAGCGCATGCA
CATCTGCCTCGCTCGAACCCAGCTACGTCTTGCGGGCGCTAGGCAACAGTGACGAGAGCGCTCACAGCAGTATCC
GCTTTGGCATTGGACGGTTTACGACGGAAATGGAGATTGATTACGTCCTCAAGGCGGTGCAGGAACGTGTCAGCT
TTTTGCGCGAGCTGAGCCCGCTCTGGGAGTTGGTCCAGGAAGGGATTGACCTCAACACAATTCAATGGAGCCAGC
ATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail