Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5377
Gene name
LocationContig_401:34..1516
Strand+
Gene length (bp)1482
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 1.3E-56 250 432
PF00364 Biotin_lipoyl Biotin-requiring enzyme 4.3E-18 44 114
PF02817 E3_binding e3 binding domain 9.5E-12 189 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 45 432 5.0E-88
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 45 432 9.0E-88
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 45 432 1.0E-85
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 20 433 4.0E-83
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 26 433 5.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 45 432 5.0E-88
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 45 432 9.0E-88
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 45 432 1.0E-85
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 20 433 4.0E-83
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 26 433 5.0E-80
sp|P21883|ODP2_BACSU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=pdhC PE=1 SV=2 45 431 2.0E-62
sp|Q59821|ODP2_STAAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus GN=pdhC PE=3 SV=1 45 431 1.0E-54
sp|Q6GHZ0|ODP2_STAAR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=pdhC PE=3 SV=1 45 431 1.0E-54
sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 45 431 2.0E-54
sp|P65635|ODP2_STAAM Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q5HGY9|ODP2_STAAC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q8CT13|ODP2_STAES Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1 45 431 3.0E-54
sp|Q5HQ74|ODP2_STAEQ Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1 45 431 3.0E-54
sp|Q9I1M0|ODB2_PSEAE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bkdB PE=1 SV=1 43 431 4.0E-50
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 45 433 7.0E-45
sp|P09062|ODB2_PSEPU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas putida GN=bkdB PE=3 SV=1 43 431 2.0E-42
sp|P11961|ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus GN=pdhC PE=1 SV=3 189 431 2.0E-42
sp|Q49110|ODP2_MYCCT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pdhC PE=3 SV=1 43 433 2.0E-42
sp|Q8K9T8|ODP2_BUCAP Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aceF PE=3 SV=2 51 430 5.0E-42
sp|P57302|ODP2_BUCAI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aceF PE=3 SV=1 51 430 3.0E-41
sp|Q89AQ9|ODP2_BUCBP Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aceF PE=3 SV=1 47 430 9.0E-41
sp|P06959|ODP2_ECOLI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3 190 430 1.0E-37
sp|P16263|ODO2_BACSU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=odhB PE=3 SV=2 47 432 5.0E-36
sp|P37942|ODB2_BACSU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=bfmBB PE=3 SV=1 39 426 5.0E-36
sp|Q59098|ODP2_CUPNH Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pdhB PE=3 SV=2 187 430 6.0E-36
sp|Q1RHI5|ODO2_RICBR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=sucB PE=3 SV=1 43 433 3.0E-35
sp|Q8CSL9|ODO2_STAES Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=odhB PE=3 SV=1 43 428 4.0E-35
sp|Q5HPC7|ODO2_STAEQ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=odhB PE=3 SV=1 43 428 7.0E-35
sp|Q92J43|ODO2_RICCN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucB PE=3 SV=1 43 432 1.0E-34
sp|Q6GGZ6|ODO2_STAAR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=odhB PE=3 SV=1 43 428 4.0E-34
sp|Q7A5N4|ODO2_STAAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=odhB PE=1 SV=1 43 428 4.0E-34
sp|Q99U75|ODO2_STAAM Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=odhB PE=3 SV=1 43 428 4.0E-34
sp|Q4UKI7|ODO2_RICFE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucB PE=3 SV=1 43 433 5.0E-34
sp|Q6FYD4|ODO2_BARQU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bartonella quintana (strain Toulouse) GN=sucB PE=3 SV=1 48 428 5.0E-34
sp|P45118|ODP2_HAEIN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aceF PE=3 SV=1 190 430 6.0E-34
sp|Q2YY06|ODO2_STAAB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=odhB PE=3 SV=1 43 428 8.0E-34
sp|Q8NWR7|ODO2_STAAW Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q6G9E9|ODO2_STAAS Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q5HG07|ODO2_STAAC Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q2FYM2|ODO2_STAA8 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain NCTC 8325) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q2FH26|ODO2_STAA3 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain USA300) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q6ABX9|ODP2_LEIXX Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdhC PE=3 SV=1 44 433 3.0E-33
sp|Q49XM4|ODO2_STAS1 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=odhB PE=3 SV=1 43 428 4.0E-33
sp|Q68XI8|ODO2_RICTY Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucB PE=3 SV=1 43 432 2.0E-31
sp|Q5M729|ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=2 SV=1 15 433 6.0E-31
sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 52 433 8.0E-31
sp|Q9ZDY4|ODO2_RICPR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=sucB PE=3 SV=1 43 433 9.0E-30
sp|Q4L6C3|ODO2_STAHJ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus haemolyticus (strain JCSC1435) GN=odhB PE=3 SV=1 43 428 3.0E-28
sp|Q8GCY1|ODO2_BARVB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bartonella vinsonii subsp. berkhoffii GN=sucB PE=3 SV=1 48 428 3.0E-28
sp|O06159|BKDC_MYCTU Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bkdC PE=1 SV=2 47 432 7.0E-28
sp|Q8RWN9|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=2 SV=2 31 433 2.0E-27
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 190 430 5.0E-27
sp|P10802|ODP2_AZOVI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Azotobacter vinelandii PE=1 SV=3 47 430 8.0E-27
sp|Q8NNJ2|ODP2_CORGL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceF PE=1 SV=1 184 431 1.0E-26
sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 65 429 1.0E-25
sp|P22439|ODPX_BOVIN Pyruvate dehydrogenase protein X component OS=Bos taurus GN=PDHX PE=1 SV=3 22 431 6.0E-25
sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 182 432 6.0E-25
sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 182 432 2.0E-24
sp|P9WIS7|ODP2_MYCTU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dlaT PE=1 SV=1 191 431 2.0E-24
sp|P9WIS6|ODP2_MYCTO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dlaT PE=3 SV=1 191 431 2.0E-24
sp|P65634|ODP2_MYCBO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dlaT PE=3 SV=1 191 431 2.0E-24
sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 189 432 4.0E-24
sp|O94681|ODO2_SCHPO Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kgd2 PE=3 SV=1 16 428 9.0E-24
sp|P0AFG6|ODO2_ECOLI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) GN=sucB PE=1 SV=2 43 428 1.0E-23
sp|P0AFG7|ODO2_ECO57 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli O157:H7 GN=sucB PE=1 SV=2 43 428 1.0E-23
sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 57 429 1.0E-23
sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 182 432 2.0E-23
sp|P19262|ODO2_YEAST Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KGD2 PE=1 SV=2 31 428 7.0E-23
sp|Q8BKZ9|ODPX_MOUSE Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=1 SV=1 22 431 2.0E-22
sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 52 429 3.0E-22
sp|Q9I3D2|ODO2_PSEAE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucB PE=3 SV=1 189 432 3.0E-22
sp|O00330|ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens GN=PDHX PE=1 SV=3 22 431 3.0E-22
sp|Q9R9N3|ODP2_RHIME Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rhizobium meliloti (strain 1021) GN=pdhC PE=3 SV=1 54 429 4.0E-22
sp|P20285|ODP2_NEUCR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-3 PE=1 SV=2 60 429 6.0E-22
sp|P47514|ODP2_MYCGE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhC PE=3 SV=1 245 433 3.0E-21
sp|P75392|ODP2_MYCPN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhC PE=3 SV=1 252 433 7.0E-21
sp|P45302|ODO2_HAEIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucB PE=3 SV=1 40 428 8.0E-21
sp|O31550|ACOC_BACSU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Bacillus subtilis (strain 168) GN=acoC PE=3 SV=1 43 429 2.0E-20
sp|P20708|ODO2_AZOVI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Azotobacter vinelandii GN=sucB PE=1 SV=2 189 432 1.0E-19
sp|P52993|ODO2_CUPNH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucB PE=3 SV=1 192 428 3.0E-19
sp|Q4ULG1|ODP2_RICFE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pdhC PE=3 SV=1 42 429 9.0E-19
sp|Q68WK6|ODP2_RICTY Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pdhC PE=3 SV=1 59 429 2.0E-18
sp|Q92HK7|ODP2_RICCN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pdhC PE=3 SV=1 43 429 2.0E-18
sp|Q869Y7|ODO2_DICDI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=odhB PE=1 SV=1 281 428 3.0E-17
sp|P11179|ODO2_BOVIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Bos taurus GN=DLST PE=1 SV=2 242 428 4.0E-17
sp|Q9N0F1|ODO2_PIG Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Sus scrofa GN=DLST PE=1 SV=1 239 428 7.0E-17
sp|Q0WQF7|ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=2 SV=2 57 430 8.0E-17
sp|Q01205|ODO2_RAT Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlst PE=1 SV=2 281 428 9.0E-17
sp|Q9D2G2|ODO2_MOUSE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlst PE=1 SV=1 281 428 9.0E-17
sp|P36957|ODO2_HUMAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLST PE=1 SV=4 281 428 1.0E-16
sp|Q9ZD20|ODP2_RICPR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=pdhC PE=3 SV=1 54 429 1.0E-16
sp|Q89AJ6|ODO2_BUCBP Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=sucB PE=3 SV=1 191 433 3.0E-16
sp|P12695|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAT1 PE=1 SV=1 36 433 6.0E-16
sp|Q90512|ODO2_TAKRU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (Fragment) OS=Takifugu rubripes GN=dlst PE=3 SV=1 240 428 6.0E-15
sp|Q9FLQ4|ODO2A_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial OS=Arabidopsis thaliana GN=At5g55070 PE=2 SV=1 281 428 5.0E-14
sp|Q9SQI8|ODP24_ARATH Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=LTA2 PE=2 SV=1 183 429 1.0E-13
sp|Q8H107|ODO2B_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial OS=Arabidopsis thaliana GN=At4g26910 PE=2 SV=2 281 428 1.0E-13
sp|Q8K9N2|ODO2_BUCAP Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=sucB PE=3 SV=1 252 428 6.0E-13
sp|P57389|ODO2_BUCAI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=sucB PE=3 SV=1 303 428 9.0E-12
sp|Q86AD5|Y1564_DICDI Pyruvate dehydrogenase complex subunit homolog DDB_G0271564, mitochondrial OS=Dictyostelium discoideum GN=pdhX PE=3 SV=1 256 429 5.0E-11
sp|A0PVU7|KGD_MYCUA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium ulcerans (strain Agy99) GN=kgd PE=3 SV=1 266 432 1.0E-10
sp|A1TDK2|KGD_MYCVP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=kgd PE=3 SV=2 252 432 6.0E-10
sp|Q1B4V6|KGD_MYCSS Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain MCS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|A1UK81|KGD_MYCSK Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain KMS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|A3Q3N5|KGD_MYCSJ Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain JLS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|Q73WX4|KGD_MYCPA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kgd PE=3 SV=1 247 432 8.0E-10
sp|Q9C8P0|ODP25_ARATH Dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=EMB3003 PE=2 SV=1 41 429 2.0E-09
sp|Q9CC97|KGD_MYCLE Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium leprae (strain TN) GN=kgd PE=3 SV=2 266 432 3.0E-09
sp|A1KI36|KGD_MYCBP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kgd PE=3 SV=2 243 432 3.0E-09
sp|Q7U0A6|KGD_MYCBO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kgd PE=3 SV=2 243 432 3.0E-09
sp|P9WIS5|KGD_MYCTU Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kgd PE=1 SV=1 243 432 4.0E-09
sp|P9WIS4|KGD_MYCTO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kgd PE=3 SV=1 243 432 4.0E-09
sp|A5U1U6|KGD_MYCTA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kgd PE=3 SV=2 243 432 4.0E-09
sp|Q8NRC3|ODO12_CORGL 2-oxoglutarate dehydrogenase E1/E2 component OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=odhA PE=1 SV=2 266 432 8.0E-09
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 47 119 2.0E-08
sp|A0R2B1|KGD_MYCS2 Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kgd PE=1 SV=1 266 432 3.0E-08
sp|P86197|ODP2_MESAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (Fragments) OS=Mesocricetus auratus GN=DLAT PE=1 SV=1 342 432 9.0E-08
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 45 120 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5377
MLSSGACRLLRRQLAVGKTLAGRTWGAPKWFSQSRRLYAAKPVLLADIGEGIVECEVIQWFVQPGARVEEFSPLC
EVQSDKASVEITSRFAGTVKKLYYEAGDMAKVGKPFVDIDIEGGTAPTEPTAALPEAKAPLQPATPPSMPTESLG
DAQTVLKAVLEAVLARESTRDSTRGELEQGKPQGKMATLATPAVRHVSRELQVDIAEISGTGRDGRVLKQDIYQF
VQQRNARQPQGQGAAPSPPRPQGQQMETQVQLSHTQQQMFKTMSRSLSIPHFVYADEVDFTRLVGLRARLNNRMA
HGDAKLSYLPFIIKAVSLALHQYPTLNARVDVDVKSGKPCLMMRSQHNVGVAMDTPQGLLVPVIKDVSSLSIATI
ATELARLQGVAQAGRLGPGDLSGGTLTVSNIGTIGGTYLSPVIVEREVAILGLGRLER*
Coding >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGCATTGTCGAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGC
GAAGTACAGAGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAA
GCCGGCGACATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCG
ACGGCTGCTCTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGA
GATGCTCAAACGGTGCTCAAGGCAGTGCTCGAGGCGGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGA
GAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGCAACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAA
CTTCAAGTGGATATTGCCGAGATATCGGGGACTGGTAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTT
GTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACAAGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAA
ATGGAGACGCAGGTACAACTTTCCCACACACAGCAACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCT
CACTTTGTCTATGCCGACGAGGTGGACTTTACTCGGCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCA
CATGGTGACGCCAAGCTGTCATACCTTCCATTCATCATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACT
CTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGGGAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGC
GTGGCCATGGACACACCGCAAGGGCTGCTGGTGCCCGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATT
GCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCAGGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACG
CTGACCGTGTCCAACATTGGGACCATTGGCGGCACCTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATC
TTGGGCCTGGGCAGGCTGGAGCGCTGA
Transcript >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGCATTGTCGAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGC
GAAGTACAGAGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAA
GCCGGCGACATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCG
ACGGCTGCTCTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGA
GATGCTCAAACGGTGCTCAAGGCAGTGCTCGAGGCGGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGA
GAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGCAACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAA
CTTCAAGTGGATATTGCCGAGATATCGGGGACTGGTAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTT
GTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACAAGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAA
ATGGAGACGCAGGTACAACTTTCCCACACACAGCAACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCT
CACTTTGTCTATGCCGACGAGGTGGACTTTACTCGGCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCA
CATGGTGACGCCAAGCTGTCATACCTTCCATTCATCATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACT
CTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGGGAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGC
GTGGCCATGGACACACCGCAAGGGCTGCTGGTGCCCGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATT
GCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCAGGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACG
CTGACCGTGTCCAACATTGGGACCATTGGCGGCACCTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATC
TTGGGCCTGGGCAGGCTGGAGCGCTGA
Gene >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGTGACTGAGAGGTAGAAGTGGCAAAAAAAAACAAATAGAGGTCAACTGACAAGAGATTCTGGTTAGGCATTGTC
GAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGCGAAGTACAG
AGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAAGCCGGCGAC
ATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCGACGGCTGCT
CTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGAGATGCTCAA
GTAGAGGCTATACCAGGTGCTCTAGACGGTGCTCGAGATGTTGCTCAAGACGGTGCTCAAGGCAGTGCTCGAGGC
GGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGAGAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGC
AACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAACTTCAAGTGGATATTGCCGAGATATCGGGGACTGG
TAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTTGTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACA
AGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAAATGGAGACGCAGGTACAACTTTCCCACACACAGCA
ACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCTCACTTTGTCTATGCCGACGAGGTGGACTTTACTCG
GCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCACATGGTGACGCCAAGCTGTCATACCTTCCATTCAT
CATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACTCTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGG
GAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGCGTGGCCATGGACACACCGCAAGGGCTGCTGGTGCC
CGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATTGCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCA
GGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACGCTGACCGTGTCCAACATTGGGACCATTGGCGGCAC
CTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATCTTGGGCCTGGGCAGGGTGCGTGCTGTGCCAGCGTT
TGACGCCAACGACTCCATTATCAAGAAGCACGTGTGCAACTTTAGCTGGAGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail