Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5377
Gene name
LocationContig_401:34..1516
Strand+
Gene length (bp)1482
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 1.3E-56 250 432
PF00364 Biotin_lipoyl Biotin-requiring enzyme 4.3E-18 44 114
PF02817 E3_binding e3 binding domain 9.5E-12 189 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 45 432 5.0E-88
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 45 432 9.0E-88
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 45 432 1.0E-85
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 20 433 4.0E-83
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 26 433 5.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 45 432 5.0E-88
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 45 432 9.0E-88
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 45 432 1.0E-85
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 20 433 4.0E-83
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 26 433 5.0E-80
sp|P21883|ODP2_BACSU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=pdhC PE=1 SV=2 45 431 2.0E-62
sp|Q59821|ODP2_STAAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus GN=pdhC PE=3 SV=1 45 431 1.0E-54
sp|Q6GHZ0|ODP2_STAAR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=pdhC PE=3 SV=1 45 431 1.0E-54
sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 45 431 2.0E-54
sp|P65635|ODP2_STAAM Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q5HGY9|ODP2_STAAC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=pdhC PE=3 SV=1 45 431 2.0E-54
sp|Q8CT13|ODP2_STAES Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1 45 431 3.0E-54
sp|Q5HQ74|ODP2_STAEQ Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1 45 431 3.0E-54
sp|Q9I1M0|ODB2_PSEAE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bkdB PE=1 SV=1 43 431 4.0E-50
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 45 433 7.0E-45
sp|P09062|ODB2_PSEPU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas putida GN=bkdB PE=3 SV=1 43 431 2.0E-42
sp|P11961|ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus GN=pdhC PE=1 SV=3 189 431 2.0E-42
sp|Q49110|ODP2_MYCCT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pdhC PE=3 SV=1 43 433 2.0E-42
sp|Q8K9T8|ODP2_BUCAP Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aceF PE=3 SV=2 51 430 5.0E-42
sp|P57302|ODP2_BUCAI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aceF PE=3 SV=1 51 430 3.0E-41
sp|Q89AQ9|ODP2_BUCBP Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aceF PE=3 SV=1 47 430 9.0E-41
sp|P06959|ODP2_ECOLI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3 190 430 1.0E-37
sp|P16263|ODO2_BACSU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=odhB PE=3 SV=2 47 432 5.0E-36
sp|P37942|ODB2_BACSU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=bfmBB PE=3 SV=1 39 426 5.0E-36
sp|Q59098|ODP2_CUPNH Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pdhB PE=3 SV=2 187 430 6.0E-36
sp|Q1RHI5|ODO2_RICBR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=sucB PE=3 SV=1 43 433 3.0E-35
sp|Q8CSL9|ODO2_STAES Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=odhB PE=3 SV=1 43 428 4.0E-35
sp|Q5HPC7|ODO2_STAEQ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=odhB PE=3 SV=1 43 428 7.0E-35
sp|Q92J43|ODO2_RICCN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucB PE=3 SV=1 43 432 1.0E-34
sp|Q6GGZ6|ODO2_STAAR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=odhB PE=3 SV=1 43 428 4.0E-34
sp|Q7A5N4|ODO2_STAAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=odhB PE=1 SV=1 43 428 4.0E-34
sp|Q99U75|ODO2_STAAM Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=odhB PE=3 SV=1 43 428 4.0E-34
sp|Q4UKI7|ODO2_RICFE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucB PE=3 SV=1 43 433 5.0E-34
sp|Q6FYD4|ODO2_BARQU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bartonella quintana (strain Toulouse) GN=sucB PE=3 SV=1 48 428 5.0E-34
sp|P45118|ODP2_HAEIN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aceF PE=3 SV=1 190 430 6.0E-34
sp|Q2YY06|ODO2_STAAB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=odhB PE=3 SV=1 43 428 8.0E-34
sp|Q8NWR7|ODO2_STAAW Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q6G9E9|ODO2_STAAS Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q5HG07|ODO2_STAAC Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q2FYM2|ODO2_STAA8 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain NCTC 8325) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q2FH26|ODO2_STAA3 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain USA300) GN=odhB PE=3 SV=1 43 428 9.0E-34
sp|Q6ABX9|ODP2_LEIXX Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdhC PE=3 SV=1 44 433 3.0E-33
sp|Q49XM4|ODO2_STAS1 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=odhB PE=3 SV=1 43 428 4.0E-33
sp|Q68XI8|ODO2_RICTY Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucB PE=3 SV=1 43 432 2.0E-31
sp|Q5M729|ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=2 SV=1 15 433 6.0E-31
sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 52 433 8.0E-31
sp|Q9ZDY4|ODO2_RICPR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=sucB PE=3 SV=1 43 433 9.0E-30
sp|Q4L6C3|ODO2_STAHJ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus haemolyticus (strain JCSC1435) GN=odhB PE=3 SV=1 43 428 3.0E-28
sp|Q8GCY1|ODO2_BARVB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bartonella vinsonii subsp. berkhoffii GN=sucB PE=3 SV=1 48 428 3.0E-28
sp|O06159|BKDC_MYCTU Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bkdC PE=1 SV=2 47 432 7.0E-28
sp|Q8RWN9|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=2 SV=2 31 433 2.0E-27
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 190 430 5.0E-27
sp|P10802|ODP2_AZOVI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Azotobacter vinelandii PE=1 SV=3 47 430 8.0E-27
sp|Q8NNJ2|ODP2_CORGL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceF PE=1 SV=1 184 431 1.0E-26
sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 65 429 1.0E-25
sp|P22439|ODPX_BOVIN Pyruvate dehydrogenase protein X component OS=Bos taurus GN=PDHX PE=1 SV=3 22 431 6.0E-25
sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 182 432 6.0E-25
sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 182 432 2.0E-24
sp|P9WIS7|ODP2_MYCTU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dlaT PE=1 SV=1 191 431 2.0E-24
sp|P9WIS6|ODP2_MYCTO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dlaT PE=3 SV=1 191 431 2.0E-24
sp|P65634|ODP2_MYCBO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dlaT PE=3 SV=1 191 431 2.0E-24
sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 189 432 4.0E-24
sp|O94681|ODO2_SCHPO Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kgd2 PE=3 SV=1 16 428 9.0E-24
sp|P0AFG6|ODO2_ECOLI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) GN=sucB PE=1 SV=2 43 428 1.0E-23
sp|P0AFG7|ODO2_ECO57 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli O157:H7 GN=sucB PE=1 SV=2 43 428 1.0E-23
sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 57 429 1.0E-23
sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 182 432 2.0E-23
sp|P19262|ODO2_YEAST Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KGD2 PE=1 SV=2 31 428 7.0E-23
sp|Q8BKZ9|ODPX_MOUSE Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=1 SV=1 22 431 2.0E-22
sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 52 429 3.0E-22
sp|Q9I3D2|ODO2_PSEAE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucB PE=3 SV=1 189 432 3.0E-22
sp|O00330|ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens GN=PDHX PE=1 SV=3 22 431 3.0E-22
sp|Q9R9N3|ODP2_RHIME Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rhizobium meliloti (strain 1021) GN=pdhC PE=3 SV=1 54 429 4.0E-22
sp|P20285|ODP2_NEUCR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-3 PE=1 SV=2 60 429 6.0E-22
sp|P47514|ODP2_MYCGE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhC PE=3 SV=1 245 433 3.0E-21
sp|P75392|ODP2_MYCPN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhC PE=3 SV=1 252 433 7.0E-21
sp|P45302|ODO2_HAEIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucB PE=3 SV=1 40 428 8.0E-21
sp|O31550|ACOC_BACSU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Bacillus subtilis (strain 168) GN=acoC PE=3 SV=1 43 429 2.0E-20
sp|P20708|ODO2_AZOVI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Azotobacter vinelandii GN=sucB PE=1 SV=2 189 432 1.0E-19
sp|P52993|ODO2_CUPNH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucB PE=3 SV=1 192 428 3.0E-19
sp|Q4ULG1|ODP2_RICFE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pdhC PE=3 SV=1 42 429 9.0E-19
sp|Q68WK6|ODP2_RICTY Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pdhC PE=3 SV=1 59 429 2.0E-18
sp|Q92HK7|ODP2_RICCN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pdhC PE=3 SV=1 43 429 2.0E-18
sp|Q869Y7|ODO2_DICDI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=odhB PE=1 SV=1 281 428 3.0E-17
sp|P11179|ODO2_BOVIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Bos taurus GN=DLST PE=1 SV=2 242 428 4.0E-17
sp|Q9N0F1|ODO2_PIG Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Sus scrofa GN=DLST PE=1 SV=1 239 428 7.0E-17
sp|Q0WQF7|ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=2 SV=2 57 430 8.0E-17
sp|Q01205|ODO2_RAT Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlst PE=1 SV=2 281 428 9.0E-17
sp|Q9D2G2|ODO2_MOUSE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlst PE=1 SV=1 281 428 9.0E-17
sp|P36957|ODO2_HUMAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLST PE=1 SV=4 281 428 1.0E-16
sp|Q9ZD20|ODP2_RICPR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=pdhC PE=3 SV=1 54 429 1.0E-16
sp|Q89AJ6|ODO2_BUCBP Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=sucB PE=3 SV=1 191 433 3.0E-16
sp|P12695|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAT1 PE=1 SV=1 36 433 6.0E-16
sp|Q90512|ODO2_TAKRU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (Fragment) OS=Takifugu rubripes GN=dlst PE=3 SV=1 240 428 6.0E-15
sp|Q9FLQ4|ODO2A_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial OS=Arabidopsis thaliana GN=At5g55070 PE=2 SV=1 281 428 5.0E-14
sp|Q9SQI8|ODP24_ARATH Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=LTA2 PE=2 SV=1 183 429 1.0E-13
sp|Q8H107|ODO2B_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial OS=Arabidopsis thaliana GN=At4g26910 PE=2 SV=2 281 428 1.0E-13
sp|Q8K9N2|ODO2_BUCAP Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=sucB PE=3 SV=1 252 428 6.0E-13
sp|P57389|ODO2_BUCAI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=sucB PE=3 SV=1 303 428 9.0E-12
sp|Q86AD5|Y1564_DICDI Pyruvate dehydrogenase complex subunit homolog DDB_G0271564, mitochondrial OS=Dictyostelium discoideum GN=pdhX PE=3 SV=1 256 429 5.0E-11
sp|A0PVU7|KGD_MYCUA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium ulcerans (strain Agy99) GN=kgd PE=3 SV=1 266 432 1.0E-10
sp|A1TDK2|KGD_MYCVP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=kgd PE=3 SV=2 252 432 6.0E-10
sp|Q1B4V6|KGD_MYCSS Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain MCS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|A1UK81|KGD_MYCSK Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain KMS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|A3Q3N5|KGD_MYCSJ Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain JLS) GN=kgd PE=3 SV=1 237 432 6.0E-10
sp|Q73WX4|KGD_MYCPA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kgd PE=3 SV=1 247 432 8.0E-10
sp|Q9C8P0|ODP25_ARATH Dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=EMB3003 PE=2 SV=1 41 429 2.0E-09
sp|Q9CC97|KGD_MYCLE Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium leprae (strain TN) GN=kgd PE=3 SV=2 266 432 3.0E-09
sp|A1KI36|KGD_MYCBP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kgd PE=3 SV=2 243 432 3.0E-09
sp|Q7U0A6|KGD_MYCBO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kgd PE=3 SV=2 243 432 3.0E-09
sp|P9WIS5|KGD_MYCTU Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kgd PE=1 SV=1 243 432 4.0E-09
sp|P9WIS4|KGD_MYCTO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kgd PE=3 SV=1 243 432 4.0E-09
sp|A5U1U6|KGD_MYCTA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kgd PE=3 SV=2 243 432 4.0E-09
sp|Q8NRC3|ODO12_CORGL 2-oxoglutarate dehydrogenase E1/E2 component OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=odhA PE=1 SV=2 266 432 8.0E-09
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 47 119 2.0E-08
sp|A0R2B1|KGD_MYCS2 Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kgd PE=1 SV=1 266 432 3.0E-08
sp|P86197|ODP2_MESAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (Fragments) OS=Mesocricetus auratus GN=DLAT PE=1 SV=1 342 432 9.0E-08
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 45 120 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5411
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5804
Ophiocordyceps australis map64 (Brazil) OphauB2|5377 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07252
Ophiocordyceps kimflemingae Ophio5|7101
Ophiocordyceps subramaniannii Hirsu2|5692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5377
MLSSGACRLLRRQLAVGKTLAGRTWGAPKWFSQSRRLYAAKPVLLADIGEGIVECEVIQWFVQPGARVEEFSPLC
EVQSDKASVEITSRFAGTVKKLYYEAGDMAKVGKPFVDIDIEGGTAPTEPTAALPEAKAPLQPATPPSMPTESLG
DAQTVLKAVLEAVLARESTRDSTRGELEQGKPQGKMATLATPAVRHVSRELQVDIAEISGTGRDGRVLKQDIYQF
VQQRNARQPQGQGAAPSPPRPQGQQMETQVQLSHTQQQMFKTMSRSLSIPHFVYADEVDFTRLVGLRARLNNRMA
HGDAKLSYLPFIIKAVSLALHQYPTLNARVDVDVKSGKPCLMMRSQHNVGVAMDTPQGLLVPVIKDVSSLSIATI
ATELARLQGVAQAGRLGPGDLSGGTLTVSNIGTIGGTYLSPVIVEREVAILGLGRLER*
Coding >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGCATTGTCGAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGC
GAAGTACAGAGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAA
GCCGGCGACATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCG
ACGGCTGCTCTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGA
GATGCTCAAACGGTGCTCAAGGCAGTGCTCGAGGCGGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGA
GAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGCAACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAA
CTTCAAGTGGATATTGCCGAGATATCGGGGACTGGTAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTT
GTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACAAGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAA
ATGGAGACGCAGGTACAACTTTCCCACACACAGCAACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCT
CACTTTGTCTATGCCGACGAGGTGGACTTTACTCGGCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCA
CATGGTGACGCCAAGCTGTCATACCTTCCATTCATCATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACT
CTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGGGAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGC
GTGGCCATGGACACACCGCAAGGGCTGCTGGTGCCCGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATT
GCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCAGGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACG
CTGACCGTGTCCAACATTGGGACCATTGGCGGCACCTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATC
TTGGGCCTGGGCAGGCTGGAGCGCTGA
Transcript >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGCATTGTCGAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGC
GAAGTACAGAGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAA
GCCGGCGACATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCG
ACGGCTGCTCTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGA
GATGCTCAAACGGTGCTCAAGGCAGTGCTCGAGGCGGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGA
GAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGCAACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAA
CTTCAAGTGGATATTGCCGAGATATCGGGGACTGGTAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTT
GTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACAAGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAA
ATGGAGACGCAGGTACAACTTTCCCACACACAGCAACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCT
CACTTTGTCTATGCCGACGAGGTGGACTTTACTCGGCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCA
CATGGTGACGCCAAGCTGTCATACCTTCCATTCATCATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACT
CTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGGGAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGC
GTGGCCATGGACACACCGCAAGGGCTGCTGGTGCCCGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATT
GCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCAGGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACG
CTGACCGTGTCCAACATTGGGACCATTGGCGGCACCTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATC
TTGGGCCTGGGCAGGCTGGAGCGCTGA
Gene >OphauB2|5377
ATGTTATCATCGGGCGCTTGTCGACTGCTGCGTAGGCAGTTGGCGGTGGGCAAGACTTTGGCAGGCAGAACATGG
GGCGCTCCAAAGTGGTTCTCCCAGTCTCGGAGGCTGTACGCCGCCAAGCCGGTGCTGCTGGCAGATATTGGCGAA
GGTGACTGAGAGGTAGAAGTGGCAAAAAAAAACAAATAGAGGTCAACTGACAAGAGATTCTGGTTAGGCATTGTC
GAGTGTGAAGTGATACAGTGGTTCGTTCAGCCAGGCGCACGCGTCGAGGAGTTCTCGCCGCTGTGCGAAGTACAG
AGCGACAAGGCCTCGGTTGAAATTACGAGCCGCTTTGCTGGCACAGTCAAGAAGCTCTACTACGAAGCCGGCGAC
ATGGCAAAGGTTGGTAAGCCATTTGTCGACATTGATATTGAGGGCGGCACAGCACCTACAGAGCCGACGGCTGCT
CTGCCCGAGGCCAAAGCTCCGTTGCAGCCTGCTACTCCCCCCAGCATGCCGACTGAGAGCCTAGGAGATGCTCAA
GTAGAGGCTATACCAGGTGCTCTAGACGGTGCTCGAGATGTTGCTCAAGACGGTGCTCAAGGCAGTGCTCGAGGC
GGTGCTCGCTCGAGAGAGCACTCGAGACAGTACCCGAGGAGAGCTTGAGCAAGGAAAGCCCCAGGGGAAAATGGC
AACCTTGGCGACACCGGCAGTCCGACATGTGTCGAGGGAACTTCAAGTGGATATTGCCGAGATATCGGGGACTGG
TAGAGACGGGAGGGTGCTCAAGCAAGATATCTACCAGTTTGTGCAGCAGCGAAATGCAAGGCAGCCACAAGGACA
AGGTGCAGCACCGTCGCCACCACGTCCTCAAGGGCAACAAATGGAGACGCAGGTACAACTTTCCCACACACAGCA
ACAAATGTTCAAGACAATGTCACGCTCATTGTCCATTCCTCACTTTGTCTATGCCGACGAGGTGGACTTTACTCG
GCTGGTGGGATTGCGGGCACGCCTCAACAATAGAATGGCACATGGTGACGCCAAGCTGTCATACCTTCCATTCAT
CATCAAGGCTGTGTCGCTGGCTCTGCATCAATACCCAACTCTCAATGCGCGCGTTGATGTGGATGTAAAGAGCGG
GAAGCCATGTCTCATGATGCGCTCGCAGCACAACGTGGGCGTGGCCATGGACACACCGCAAGGGCTGCTGGTGCC
CGTCATCAAGGACGTGAGCAGCCTCAGTATTGCCACCATTGCGACGGAGCTGGCGAGGCTGCAGGGCGTGGCCCA
GGCTGGCCGTCTTGGGCCCGGCGACCTATCGGGAGGCACGCTGACCGTGTCCAACATTGGGACCATTGGCGGCAC
CTATCTCAGCCCCGTCATTGTCGAGCGCGAGGTGGCCATCTTGGGCCTGGGCAGGGTGCGTGCTGTGCCAGCGTT
TGACGCCAACGACTCCATTATCAAGAAGCACGTGTGCAACTTTAGCTGGAGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail