Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5376
Gene name
LocationContig_40:123552..137073
Strand+
Gene length (bp)13521
Transcript length (bp)13305
Coding sequence length (bp)13305
Protein length (aa) 4435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.4E-68 33 422
PF00501 AMP-binding AMP-binding enzyme 5.5E-78 1066 1460
PF00501 AMP-binding AMP-binding enzyme 1.3E-78 2646 3045
PF00668 Condensation Condensation domain 9.2E-31 742 1032
PF00668 Condensation Condensation domain 2.0E-09 1696 1883
PF00668 Condensation Condensation domain 9.3E-27 2202 2619
PF00668 Condensation Condensation domain 1.7E-29 3290 3656
PF00668 Condensation Condensation domain 2.4E-22 3834 4143
PF00550 PP-binding Phosphopantetheine attachment site 2.9E-05 540 597
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-09 1593 1658
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-06 2100 2164
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-04 3184 3243
PF00550 PP-binding Phosphopantetheine attachment site 6.5E-09 3730 3791
PF00550 PP-binding Phosphopantetheine attachment site 5.4E-09 4279 4342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2097 4266 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2093 4431 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 36 2578 1.0E-178
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 30 2145 2.0E-172
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 32 2485 2.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2097 4266 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2093 4431 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 36 2578 1.0E-178
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 30 2145 2.0E-172
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 32 2485 2.0E-161
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 78 2059 4.0E-150
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 43 2038 2.0E-145
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 46 1982 2.0E-143
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 79 2035 9.0E-142
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 48 1840 7.0E-141
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 10 1850 1.0E-138
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 486 2572 3.0E-136
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2053 4145 1.0E-135
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 23 1882 3.0E-134
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 48 1675 2.0E-133
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 75 1884 3.0E-132
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 48 1884 1.0E-131
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 48 1884 2.0E-131
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 76 1880 9.0E-129
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 48 1672 3.0E-128
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 4 1722 2.0E-127
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 46 1907 1.0E-126
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2105 3678 1.0E-126
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 48 1874 1.0E-125
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 48 1880 6.0E-125
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 32 1674 2.0E-124
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 48 1666 4.0E-124
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 9 1857 5.0E-124
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 48 1846 4.0E-123
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 48 1877 3.0E-122
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 7 1667 3.0E-120
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 48 1843 3.0E-120
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 21 1835 1.0E-118
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 47 1661 1.0E-118
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 78 1658 4.0E-118
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 79 1661 1.0E-117
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 48 1876 7.0E-117
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 74 1883 1.0E-116
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 48 1880 6.0E-116
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2059 3670 1.0E-115
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 48 1879 2.0E-115
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 76 1843 2.0E-115
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 48 1666 4.0E-115
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 48 1880 2.0E-114
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5 1646 3.0E-114
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5 1646 5.0E-114
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 78 1658 6.0E-114
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 79 1666 9.0E-114
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 79 1875 1.0E-113
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 23 1847 9.0E-113
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 45 1877 6.0E-112
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 48 1840 1.0E-110
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 47 1779 3.0E-110
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 47 1628 4.0E-110
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 47 1779 9.0E-110
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 48 1637 2.0E-109
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 47 1955 1.0E-108
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2639 4159 2.0E-106
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2100 3687 4.0E-104
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 48 1670 4.0E-103
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 48 1846 2.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2095 3628 6.0E-101
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1091 3037 1.0E-99
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2200 3626 2.0E-95
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 78 995 8.0E-95
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 78 1855 5.0E-94
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2181 3620 7.0E-91
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2639 3661 1.0E-90
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2200 3796 3.0E-90
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2200 3617 6.0E-90
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2081 3628 1.0E-88
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 48 1662 3.0E-88
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 635 1848 3.0E-85
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2200 3617 3.0E-83
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1089 2010 3.0E-83
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 638 2005 2.0E-82
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2192 3625 3.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2629 3617 4.0E-81
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2200 3599 1.0E-80
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1062 1992 2.0E-80
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 749 2052 2.0E-80
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 754 1847 2.0E-80
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 754 1840 3.0E-80
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 591 1963 3.0E-80
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 627 1882 1.0E-79
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2110 3244 4.0E-79
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 638 1884 9.0E-79
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2208 3631 1.0E-78
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2090 3313 1.0E-78
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2159 3615 2.0E-78
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2181 3146 3.0E-77
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2245 3617 3.0E-77
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2002 3602 2.0E-76
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 47 1496 3.0E-76
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2641 3601 3.0E-76
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 754 1880 5.0E-76
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2208 3617 7.0E-76
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1095 2050 9.0E-76
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2206 3617 8.0E-75
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 733 1839 1.0E-74
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2095 3701 2.0E-74
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2570 3656 4.0E-74
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2196 3627 5.0E-74
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2245 3624 6.0E-74
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 23 943 7.0E-74
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2095 3362 7.0E-74
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 742 1848 1.0E-73
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 742 1837 1.0E-73
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2218 3146 1.0E-73
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2122 3232 2.0E-73
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2249 3614 5.0E-73
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 673 1880 6.0E-73
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2193 3618 1.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 629 1880 1.0E-72
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 48 959 1.0E-72
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 742 1656 2.0E-72
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 754 1659 2.0E-72
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2210 3617 4.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2632 3601 7.0E-72
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2095 3365 1.0E-71
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2125 3617 2.0E-71
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 78 1029 2.0E-71
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 754 1749 3.0E-71
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2187 3599 3.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2199 3618 8.0E-71
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 754 1884 4.0E-70
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 754 1884 6.0E-70
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2095 3365 8.0E-70
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 32 1653 1.0E-69
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2199 3639 2.0E-69
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2245 3614 2.0E-69
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 47 993 3.0E-69
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2641 3564 3.0E-69
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2095 3701 4.0E-69
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2245 3614 6.0E-69
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2199 3639 6.0E-69
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 7 820 7.0E-69
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2201 3358 3.0E-68
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 635 1660 4.0E-68
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 734 1854 5.0E-68
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 742 1666 7.0E-68
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2641 3594 7.0E-68
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2199 3627 9.0E-68
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2114 3648 9.0E-68
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2188 3617 9.0E-68
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2088 3146 1.0E-67
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2177 3225 1.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2198 3631 1.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2141 3241 1.0E-67
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2413 3242 2.0E-67
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2098 3424 3.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 48 904 6.0E-67
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2641 3594 8.0E-67
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 75 911 1.0E-66
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2195 3146 2.0E-66
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1066 1887 2.0E-66
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2200 3622 4.0E-66
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 48 700 6.0E-66
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 81 940 7.0E-66
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1918 3618 2.0E-65
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2635 3623 3.0E-65
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2247 3348 4.0E-65
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2185 3357 4.0E-65
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 44 772 4.0E-65
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 754 1668 5.0E-65
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2199 3617 7.0E-65
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 734 1907 7.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2179 3641 8.0E-65
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 614 1867 1.0E-64
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2406 3617 1.0E-64
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 732 1888 2.0E-64
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 749 1843 2.0E-64
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2641 3617 2.0E-64
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 635 1662 3.0E-64
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2191 3358 4.0E-64
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2098 3224 4.0E-64
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1024 1877 6.0E-64
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1066 1877 1.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1066 1887 1.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 76 911 2.0E-63
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2225 3252 2.0E-63
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 24 1050 3.0E-63
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 22 772 6.0E-63
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2208 3146 7.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2208 3661 1.0E-62
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2199 3241 1.0E-62
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 742 1855 1.0E-62
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1095 2092 2.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2182 3146 5.0E-62
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2088 3601 7.0E-62
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 48 600 7.0E-62
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 753 1656 1.0E-61
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2095 3349 1.0E-61
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2641 3146 2.0E-61
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2245 3146 2.0E-61
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 48 928 2.0E-61
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1066 1747 2.0E-61
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 47 961 2.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2119 3278 2.0E-61
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 48 959 3.0E-61
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 48 779 3.0E-61
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 164 1691 4.0E-61
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2640 3613 5.0E-61
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2088 3601 6.0E-61
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 544 1847 7.0E-61
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2332 3146 7.0E-61
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2100 3530 8.0E-61
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2113 3357 9.0E-61
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 754 1847 1.0E-60
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 48 617 1.0E-60
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2201 3356 2.0E-60
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1095 1987 3.0E-60
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 48 602 3.0E-60
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 48 575 5.0E-60
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2112 3245 6.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2121 3247 8.0E-60
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 732 1659 9.0E-60
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2444 3563 1.0E-59
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1062 1880 1.0E-59
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 48 910 2.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2641 3618 2.0E-59
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2199 3270 4.0E-59
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2641 3496 4.0E-59
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2092 3628 6.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1095 1861 6.0E-59
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 48 699 8.0E-59
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 749 1560 8.0E-59
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2048 3545 8.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1001 1659 1.0E-58
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 78 908 2.0E-58
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2600 3246 5.0E-58
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2675 3624 5.0E-58
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1095 1983 7.0E-58
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 629 1847 1.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 48 689 4.0E-57
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 43 912 5.0E-57
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2196 3140 5.0E-57
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2456 3237 9.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2245 3547 1.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 48 647 1.0E-56
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2123 3216 1.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2114 3215 2.0E-56
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2674 3556 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 48 773 3.0E-56
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2426 3232 4.0E-56
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1082 1984 7.0E-56
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1095 2003 8.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2448 3215 2.0E-55
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 47 959 3.0E-55
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 48 512 4.0E-55
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1085 1887 4.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 754 1874 5.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 78 918 7.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2231 3428 1.0E-54
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2623 3245 2.0E-54
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2641 3242 2.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 40 512 2.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 754 1839 2.0E-54
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2641 3674 2.0E-54
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1095 1837 3.0E-54
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1095 1559 7.0E-54
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 48 512 2.0E-53
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1095 1660 2.0E-53
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3143 4148 2.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1095 1837 3.0E-53
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2390 3377 8.0E-53
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 48 906 9.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2448 3251 1.0E-52
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 734 1559 2.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 48 699 2.0E-52
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1008 1876 3.0E-52
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1095 1954 3.0E-52
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1095 2061 6.0E-52
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 77 596 8.0E-52
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2097 3146 1.0E-51
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 857 1847 1.0E-51
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1095 2061 1.0E-51
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 754 1469 2.0E-51
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 48 908 3.0E-51
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2330 3088 4.0E-51
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 48 600 6.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1062 1655 1.0E-50
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 7 928 2.0E-50
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1107 1979 3.0E-50
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2442 3599 5.0E-50
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2696 3643 8.0E-50
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 47 775 8.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2201 3257 8.0E-50
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1010 1876 1.0E-49
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 48 602 1.0E-49
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2194 3617 1.0E-49
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2641 3674 3.0E-49
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1081 1837 4.0E-49
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2641 3674 4.0E-49
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2788 3635 4.0E-49
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1566 2540 7.0E-49
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2675 3454 1.0E-48
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 962 1847 2.0E-48
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2093 3222 3.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 744 1669 5.0E-48
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 744 1669 5.0E-48
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4 512 2.0E-47
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2296 3222 2.0E-47
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2675 3225 2.0E-47
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2095 3098 3.0E-47
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2589 3247 3.0E-47
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2589 3241 3.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 48 514 4.0E-47
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 78 525 5.0E-47
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 980 2055 7.0E-47
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 47 939 7.0E-47
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2675 3651 8.0E-47
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 48 596 1.0E-46
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 46 595 2.0E-46
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 47 939 2.0E-46
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 47 939 2.0E-46
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2589 3241 3.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 7 575 4.0E-46
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 46 760 4.0E-46
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 48 594 2.0E-45
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 79 595 3.0E-45
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 799 1654 6.0E-45
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 13 512 1.0E-44
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2672 3152 1.0E-44
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1095 1655 2.0E-44
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 91 593 3.0E-44
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 91 593 4.0E-44
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2077 3146 7.0E-44
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2095 3440 3.0E-43
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1082 1559 5.0E-43
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 47 976 6.0E-43
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 48 515 4.0E-42
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 48 515 4.0E-42
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 48 515 4.0E-42
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2316 3477 6.0E-42
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 48 515 6.0E-42
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 48 515 6.0E-42
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 48 515 6.0E-42
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 48 515 6.0E-42
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 48 515 6.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 29 512 7.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 48 515 7.0E-42
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 48 515 9.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 76 456 1.0E-41
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 48 515 1.0E-41
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 48 515 1.0E-41
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 79 577 1.0E-41
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 79 577 1.0E-41
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 79 577 1.0E-41
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2707 3152 2.0E-41
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2707 3152 2.0E-41
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 48 515 2.0E-41
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2707 3152 2.0E-41
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 48 515 3.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 48 515 3.0E-41
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 48 600 4.0E-41
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2707 3148 5.0E-41
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2707 3148 5.0E-41
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2707 3148 5.0E-41
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2707 3148 5.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2707 3152 5.0E-41
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2707 3148 8.0E-41
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2707 3148 8.0E-41
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2707 3148 8.0E-41
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2707 3148 8.0E-41
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2707 3148 1.0E-40
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1095 1982 1.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2707 3152 2.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2707 3152 2.0E-40
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 48 515 2.0E-40
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1023 1628 4.0E-40
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2707 3152 4.0E-40
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 85 779 5.0E-40
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2641 3146 6.0E-40
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1083 1561 1.0E-39
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1083 1561 1.0E-39
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2203 3215 1.0E-39
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2203 3215 2.0E-39
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1083 1561 6.0E-39
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 537 1447 7.0E-39
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 79 593 2.0E-38
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2674 3146 5.0E-38
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 80 515 7.0E-38
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2574 3617 1.0E-37
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 80 515 1.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2714 3146 1.0E-37
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1083 1561 1.0E-37
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2790 3146 1.0E-37
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 75 515 2.0E-37
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2695 3254 2.0E-37
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2676 3791 3.0E-37
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1083 1561 4.0E-37
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1083 1560 4.0E-37
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 45 515 6.0E-37
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 80 515 6.0E-37
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1062 1559 9.0E-37
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1062 1559 9.0E-37
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1062 1559 1.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 816 1561 1.0E-36
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 48 512 1.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1062 1559 2.0E-36
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1062 1559 2.0E-36
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1062 1559 2.0E-36
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1062 1559 2.0E-36
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1062 1559 2.0E-36
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2229 3215 2.0E-36
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 635 1566 3.0E-36
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1062 1559 4.0E-36
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1062 1559 5.0E-36
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1062 1559 5.0E-36
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1062 1559 5.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1062 1559 5.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1062 1559 5.0E-36
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 91 577 6.0E-36
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1064 1559 8.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1062 1559 8.0E-36
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2675 3148 8.0E-36
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1064 1559 1.0E-35
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2675 3148 1.0E-35
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1083 1559 2.0E-35
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2675 3148 2.0E-35
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 48 810 2.0E-35
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 45 512 2.0E-35
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 79 600 2.0E-35
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 48 810 3.0E-35
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2675 3148 4.0E-35
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 21 512 4.0E-35
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 48 807 5.0E-35
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1064 1559 6.0E-35
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2675 3148 6.0E-35
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 21 512 6.0E-35
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2675 3146 8.0E-35
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2675 3147 1.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2585 3149 2.0E-34
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2585 3149 2.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 748 1559 3.0E-34
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2625 3215 3.0E-34
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 748 1559 4.0E-34
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2625 3215 4.0E-34
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2625 3215 4.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 79 548 5.0E-34
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1095 1560 6.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 33 515 7.0E-34
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 48 512 1.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 33 515 2.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 42 512 2.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 33 515 3.0E-33
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 32 517 4.0E-33
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 32 512 4.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1095 1559 7.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2675 3146 1.0E-32
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2675 3146 1.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2713 3146 2.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2675 3146 2.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 32 512 2.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 32 512 3.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 32 512 3.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 32 512 3.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 32 512 3.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 32 512 3.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 32 512 3.0E-32
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2638 3146 4.0E-32
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1095 1559 4.0E-32
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 32 512 4.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 46 515 6.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 46 515 7.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 46 515 7.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 48 625 7.0E-32
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2628 3146 2.0E-31
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2631 3564 3.0E-31
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2675 3146 5.0E-31
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2675 3146 5.0E-31
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2675 3146 5.0E-31
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2675 3146 5.0E-31
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2675 3146 5.0E-31
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2675 3146 5.0E-31
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 48 515 5.0E-31
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 48 515 5.0E-31
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 48 515 5.0E-31
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 48 515 6.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2714 3148 7.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2714 3148 7.0E-31
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 48 515 7.0E-31
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3723 4431 8.0E-31
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2714 3148 1.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2638 3146 1.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2641 3147 4.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1003 1655 5.0E-30
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2714 3146 7.0E-30
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2714 3146 7.0E-30
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2714 3146 8.0E-30
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2714 3146 9.0E-30
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2714 3146 9.0E-30
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2714 3146 9.0E-30
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2714 3146 1.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2714 3146 1.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2714 3146 1.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2714 3146 1.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2714 3146 1.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1096 1559 2.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1096 1559 2.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1096 1559 2.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 46 519 2.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2713 3148 2.0E-29
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1095 1559 2.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1096 1559 3.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2714 3146 4.0E-29
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 47 512 4.0E-29
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2641 3246 6.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1096 1559 7.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1096 1559 7.0E-29
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 48 805 7.0E-29
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2695 3212 7.0E-29
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2672 3146 8.0E-29
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 520 1022 9.0E-29
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 637 1561 9.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 80 519 1.0E-28
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1066 1658 1.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 47 515 1.0E-28
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2790 3146 2.0E-28
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 95 444 2.0E-28
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2639 3146 2.0E-28
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2714 3146 3.0E-28
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2714 3146 3.0E-28
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2714 3146 3.0E-28
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2714 3146 3.0E-28
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 975 1728 5.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 47 469 1.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1083 1559 1.0E-27
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2641 3220 2.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1093 1559 2.0E-27
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2714 3146 3.0E-27
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2714 3146 3.0E-27
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3729 4275 4.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3730 4433 4.0E-27
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2675 3146 4.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1096 1561 5.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1096 1561 5.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2716 3088 7.0E-27
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2460 3149 7.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1096 1561 8.0E-27
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1066 1700 1.0E-26
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 47 519 2.0E-26
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1093 1559 2.0E-26
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2559 3238 3.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2200 3153 3.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1093 1559 3.0E-26
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 47 519 5.0E-26
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 47 519 5.0E-26
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 47 519 5.0E-26
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 47 519 5.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1096 1561 9.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3688 4241 1.0E-25
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3750 4122 2.0E-25
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2587 3245 2.0E-25
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1095 1559 2.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 47 519 3.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 47 519 3.0E-25
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1096 1559 4.0E-25
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1095 1559 4.0E-25
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1095 1559 5.0E-25
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1095 1559 1.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3745 4233 1.0E-24
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1095 1559 1.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1095 1559 3.0E-24
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2631 3267 4.0E-24
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1135 1559 5.0E-24
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1115 1660 5.0E-24
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1135 1559 1.0E-23
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1135 1559 1.0E-23
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1135 1559 1.0E-23
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1135 1559 1.0E-23
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 45 578 2.0E-23
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2637 3088 5.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 32 515 6.0E-23
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1135 1559 1.0E-22
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1135 1559 1.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3129 3626 1.0E-22
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 984 1559 2.0E-22
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3724 4144 2.0E-22
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2699 3245 3.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3724 4113 3.0E-22
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 759 1557 4.0E-22
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1120 1674 1.0E-21
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 38 456 2.0E-21
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3717 4163 2.0E-21
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3724 4235 2.0E-21
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1096 1504 5.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3824 4242 5.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 92 514 7.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3118 3563 8.0E-21
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 20 514 2.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 48 421 2.0E-20
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3730 4235 2.0E-20
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3724 4235 2.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1497 1929 3.0E-20
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3735 4208 3.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 399 906 6.0E-20
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3730 4235 6.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3745 4431 8.0E-20
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1066 1658 2.0E-19
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1094 1559 2.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3121 3645 2.0E-19
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1020 1667 4.0E-19
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1020 1667 4.0E-19
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1020 1667 4.0E-19
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2634 3148 6.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2023 2602 6.0E-19
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2648 3158 7.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3730 4124 8.0E-19
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3592 4128 1.0E-18
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 48 512 1.0E-18
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3735 4156 2.0E-18
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3287 3652 3.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2980 3617 4.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1138 1500 4.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 364 960 5.0E-18
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1061 1926 5.0E-18
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 42 516 6.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2114 2485 7.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3287 3701 1.0E-17
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3734 4433 1.0E-17
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3832 4231 3.0E-17
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2648 3159 3.0E-17
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3832 4231 6.0E-17
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 43 512 6.0E-17
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2664 3147 6.0E-17
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 7 516 7.0E-17
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 2664 3147 7.0E-17
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 40 542 8.0E-17
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 47 618 1.0E-16
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3818 4170 2.0E-16
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3832 4231 3.0E-16
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3737 4113 3.0E-16
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2787 3158 4.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3285 3625 5.0E-16
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1069 1563 6.0E-16
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3822 4144 7.0E-16
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3829 4224 8.0E-16
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 78 575 1.0E-15
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 171 512 1.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2674 3215 1.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3287 3617 2.0E-15
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2639 3147 2.0E-15
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1087 1560 2.0E-15
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2645 3150 2.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3823 4178 2.0E-15
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 79 507 3.0E-15
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 79 507 3.0E-15
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1059 1561 3.0E-15
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1214 1559 3.0E-15
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2674 3147 4.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2714 3215 5.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3286 3617 7.0E-15
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 2674 3147 7.0E-15
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2641 3147 8.0E-15
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2641 3147 8.0E-15
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1216 1563 1.0E-14
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1095 1559 1.0E-14
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3724 4156 1.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1061 1560 2.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1096 1563 2.0E-14
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2675 3152 2.0E-14
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2 452 3.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3130 3617 3.0E-14
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2674 3147 3.0E-14
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 1088 1563 3.0E-14
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2674 3147 4.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1690 2077 4.0E-14
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 1078 1556 5.0E-14
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 73 519 5.0E-14
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1201 1561 6.0E-14
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1087 1563 6.0E-14
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1082 1560 7.0E-14
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3830 4162 8.0E-14
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1211 1559 8.0E-14
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 1216 1566 8.0E-14
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3313 3617 9.0E-14
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1096 1560 9.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3803 4161 9.0E-14
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 167 507 1.0E-13
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2674 3147 1.0E-13
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1059 1561 1.0E-13
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2674 3147 1.0E-13
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2674 3147 1.0E-13
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2674 3147 1.0E-13
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2674 3147 1.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3831 4116 1.0E-13
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1096 1560 2.0E-13
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 168 512 2.0E-13
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1210 1560 2.0E-13
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1210 1560 2.0E-13
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 1208 1565 2.0E-13
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2674 3147 2.0E-13
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1082 1560 2.0E-13
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 169 516 2.0E-13
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2674 3147 2.0E-13
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2674 3147 2.0E-13
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2674 3147 2.0E-13
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2674 3147 2.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2095 2622 3.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 102 521 3.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1204 1473 3.0E-13
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 1059 1556 3.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2675 3618 4.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 43 507 4.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1209 1568 4.0E-13
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2674 3147 4.0E-13
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2674 3147 4.0E-13
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1060 1560 5.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3839 4231 6.0E-13
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1058 1556 6.0E-13
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2674 3147 6.0E-13
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2674 3147 6.0E-13
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2674 3147 6.0E-13
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1216 1573 6.0E-13
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 2674 3147 6.0E-13
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 2674 3147 6.0E-13
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2664 3147 6.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1086 1672 6.0E-13
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 169 512 6.0E-13
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3832 4114 7.0E-13
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2641 3147 7.0E-13
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2641 3147 7.0E-13
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1180 1565 9.0E-13
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2664 3147 9.0E-13
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2664 3147 9.0E-13
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 2674 3147 1.0E-12
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2639 3150 1.0E-12
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2674 3147 1.0E-12
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2674 3147 1.0E-12
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1213 1560 1.0E-12
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 159 515 1.0E-12
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2664 3147 1.0E-12
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 1059 1560 2.0E-12
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2674 3147 2.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 33 512 2.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 33 512 2.0E-12
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 119 512 2.0E-12
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 33 513 2.0E-12
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1074 1560 2.0E-12
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2639 3088 2.0E-12
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 78 456 3.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 33 512 3.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2695 3140 3.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3831 4142 3.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3286 3617 3.0E-12
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2674 3090 4.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 632 961 4.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3832 4142 4.0E-12
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 171 512 5.0E-12
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 1209 1560 5.0E-12
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 1209 1560 5.0E-12
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 1209 1560 5.0E-12
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3285 3627 5.0E-12
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2980 3142 6.0E-12
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1095 1560 6.0E-12
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1095 1560 6.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2648 3148 6.0E-12
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 31 512 6.0E-12
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 31 512 6.0E-12
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1087 1559 7.0E-12
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1082 1559 8.0E-12
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 166 512 8.0E-12
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2675 3152 8.0E-12
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2675 3152 8.0E-12
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1062 1565 9.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1213 1560 9.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1213 1560 9.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3743 4129 9.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1213 1560 1.0E-11
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2664 3147 1.0E-11
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 1074 1570 1.0E-11
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2664 3147 1.0E-11
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2664 3147 1.0E-11
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2664 3147 1.0E-11
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1061 1560 1.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2639 3088 1.0E-11
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 96 518 1.0E-11
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2668 3147 1.0E-11
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2664 3147 2.0E-11
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2664 3147 2.0E-11
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3281 3626 2.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3805 4195 2.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3287 3844 2.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2640 3088 2.0E-11
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3287 3634 2.0E-11
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2797 3151 3.0E-11
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 119 507 3.0E-11
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 167 507 3.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3829 4117 3.0E-11
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2797 3151 3.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3857 4162 3.0E-11
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 167 512 4.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1218 1561 4.0E-11
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 1074 1570 4.0E-11
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2639 3148 4.0E-11
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 170 577 4.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3751 4197 4.0E-11
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3262 3618 5.0E-11
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1096 1560 5.0E-11
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 92 514 7.0E-11
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 1096 1566 7.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 47 514 7.0E-11
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3812 4169 8.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 165 521 1.0E-10
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 165 521 1.0E-10
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3821 4182 1.0E-10
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2664 3147 1.0E-10
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 52 512 1.0E-10
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 93 512 1.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3828 4142 1.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1214 1559 1.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3287 3646 2.0E-10
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2646 3147 2.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1084 1566 2.0E-10
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 1074 1560 2.0E-10
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 1078 1556 2.0E-10
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1081 1560 2.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1218 1560 2.0E-10
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1214 1560 2.0E-10
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2639 3148 2.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 170 521 2.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3287 3633 3.0E-10
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3830 4162 3.0E-10
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1201 1560 3.0E-10
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2797 3151 3.0E-10
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 1215 1560 3.0E-10
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1201 1560 3.0E-10
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1214 1560 3.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1164 1569 3.0E-10
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 131 512 3.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2097 2537 3.0E-10
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 169 512 3.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2783 3094 4.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 173 514 4.0E-10
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 167 512 4.0E-10
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 165 507 4.0E-10
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2639 3088 5.0E-10
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 168 520 5.0E-10
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3831 4142 5.0E-10
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2796 3071 5.0E-10
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 2720 3091 6.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 624 939 6.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2695 3153 7.0E-10
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2672 3095 7.0E-10
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 2639 3067 7.0E-10
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2697 3153 7.0E-10
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 1074 1560 7.0E-10
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 167 514 8.0E-10
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1074 1560 8.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 52 512 8.0E-10
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 2641 3087 8.0E-10
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1081 1560 8.0E-10
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 171 512 9.0E-10
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2688 3146 1.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2115 2610 1.0E-09
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2639 3147 1.0E-09
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2095 2510 1.0E-09
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1124 1560 1.0E-09
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 79 515 1.0E-09
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 165 512 1.0E-09
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1218 1565 1.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2687 3158 1.0E-09
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2639 3084 2.0E-09
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 1171 1560 2.0E-09
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 1074 1560 2.0E-09
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2644 3153 2.0E-09
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 1078 1554 2.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1095 1560 2.0E-09
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 2671 3097 2.0E-09
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3285 3617 2.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2121 2562 3.0E-09
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2695 3153 3.0E-09
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1088 1473 3.0E-09
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 1096 1560 3.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 698 915 3.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2786 3088 4.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3823 4162 4.0E-09
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2695 3153 4.0E-09
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2789 3088 4.0E-09
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 1095 1560 4.0E-09
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 2603 3049 5.0E-09
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 165 512 5.0E-09
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2781 3157 5.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2631 3088 5.0E-09
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1214 1560 5.0E-09
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2687 3153 5.0E-09
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2650 3148 5.0E-09
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2785 3096 6.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 167 452 6.0E-09
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2797 3147 6.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3831 4118 7.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2712 3149 7.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2781 3157 7.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2781 3157 7.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2781 3157 7.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 2782 3153 7.0E-09
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 175 512 7.0E-09
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2695 3153 8.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2781 3157 9.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2781 3157 9.0E-09
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 2689 3148 1.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2697 3153 1.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2781 3157 1.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2672 3097 1.0E-08
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2697 3153 1.0E-08
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2697 3153 1.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2781 3157 1.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 144 519 1.0E-08
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2102 2567 1.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2796 3094 1.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3832 4096 2.0E-08
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3724 4118 2.0E-08
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 123 512 2.0E-08
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 123 512 2.0E-08
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 167 512 2.0E-08
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1095 1473 2.0E-08
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 24 525 2.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2781 3148 2.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2781 3148 2.0E-08
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 165 525 2.0E-08
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 1215 1560 2.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1218 1560 2.0E-08
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2695 3153 2.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1218 1565 2.0E-08
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3286 3618 3.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 78 512 3.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1096 1561 3.0E-08
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2695 3153 3.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2781 3157 3.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2781 3157 3.0E-08
sp|P44565|MENE_HAEIN 2-succinylbenzoate--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menE PE=3 SV=1 1094 1559 3.0E-08
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 1074 1560 3.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1198 1563 3.0E-08
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2797 3154 3.0E-08
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 123 512 3.0E-08
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 167 516 4.0E-08
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3724 4152 4.0E-08
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 1122 1561 4.0E-08
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1087 1557 4.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2671 3071 4.0E-08
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2796 3095 4.0E-08
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 747 968 5.0E-08
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 126 453 5.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 167 512 5.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2781 3148 5.0E-08
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2695 3088 5.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1689 1983 5.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3191 3619 6.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1214 1559 6.0E-08
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 2788 3153 6.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2789 3156 7.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3281 3600 7.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 165 522 7.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2797 3147 8.0E-08
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2784 3094 8.0E-08
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 1324 1472 8.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 165 523 8.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1214 1560 8.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 169 447 8.0E-08
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 91 507 9.0E-08
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 2720 3073 1.0E-07
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1346 1566 1.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3287 3617 1.0E-07
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 161 512 1.0E-07
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 1122 1464 1.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 487 995 1.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2674 3071 1.0E-07
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 165 525 1.0E-07
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 1324 1486 1.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1216 1560 1.0E-07
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 1324 1472 1.0E-07
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 168 515 1.0E-07
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 3735 4235 1.0E-07
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3730 4168 2.0E-07
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 2782 3154 2.0E-07
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 169 512 2.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1209 1559 2.0E-07
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 1324 1487 2.0E-07
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2795 3147 3.0E-07
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2672 3097 3.0E-07
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 151 507 3.0E-07
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 65 512 3.0E-07
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 78 513 3.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 163 513 3.0E-07
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 1324 1566 3.0E-07
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3829 4164 3.0E-07
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 165 507 4.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2796 3146 4.0E-07
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2725 3153 4.0E-07
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 168 507 4.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 484 824 5.0E-07
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1095 1473 5.0E-07
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2785 3088 5.0E-07
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2790 3071 6.0E-07
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 166 389 7.0E-07
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 168 515 7.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 169 513 8.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 745 941 9.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 1214 1559 9.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1209 1573 1.0E-06
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2797 3055 1.0E-06
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 131 512 1.0E-06
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 168 551 1.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 131 512 1.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1212 1473 1.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 167 512 1.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3106 3361 2.0E-06
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 91 507 2.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4280 4433 2.0E-06
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 169 512 2.0E-06
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 171 452 2.0E-06
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1214 1559 2.0E-06
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 1216 1560 2.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2749 3146 2.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2749 3146 2.0E-06
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2792 3147 3.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 2687 3147 3.0E-06
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1214 1560 3.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1214 1559 3.0E-06
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 167 512 3.0E-06
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 1060 1312 3.0E-06
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 2749 3146 3.0E-06
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 2749 3146 3.0E-06
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 2749 3146 3.0E-06
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 2749 3146 3.0E-06
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 2749 3146 3.0E-06
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3743 4175 4.0E-06
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 168 525 4.0E-06
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2672 3097 4.0E-06
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 172 507 4.0E-06
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 1087 1560 4.0E-06
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 41 406 4.0E-06
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 41 406 4.0E-06
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 41 406 4.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3872 4116 4.0E-06
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 168 571 4.0E-06
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 168 512 5.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2790 3071 6.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2788 3058 6.0E-06
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 7 513 6.0E-06
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 118 460 8.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 2672 3097 9.0E-06
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 2643 2812 9.0E-06
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2792 3147 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5376
MDAHHHLSSLNQNPAKLAGPGLLHHLVGPPSQRLALEHSSHNKTTLYTYRDLDDASEAVAQRITAACCHATPSLS
DFVVPVLVSQSALLYISLLGVLKAGGAFCPVAIDAPLERIRFILDDVSAQVVVVSKDLASRIPQDTRLQVICVDD
LHFRLSNGPAIHRQPVPQDLAYVMYTSGSTGTPKGVAITHLAVTQALLAHNRHVPQFNRFLQFAAPTFDVSVFEI
FFPLFRGSTLVSVRRQEMLDDLPAVIRKMDVDACELTPTVASSLLRSRDDAPSLKLLLTIGEMLKTPVVREFGAS
LHRQGILWAMYGPTEATIHCTLQTAMSSESSTTNIGVPLDSVSCFIIEPLEDSTAKPCEFKILPIGEAGELAIGG
HQLARGYLNRPEQTAAAFIQSPYGRLYRTGDRARLTASGTLECLGRLVSGQVKLRGQRIELGEIEHAVLETPGCH
DAVAAVVDSNLVAFCAVDHHVTQDALISTCAEWLPRFMVPAEFVLMQYLPRLSSGKVDTKKLLSDFGEQRATSLG
FESADTRLDSHQHLVLEIVSTILGIRVNEKMTMAAAGVDSLAAIKLASALRRQGFDAIATELLRLKTLSDLCCTL
LKRPFVESITRELSGEQGLRLTIPPVGDRQPAATDCLPCTFLQSAMLAETVQDVEMYCNEIELQVNSDISLDAIC
AAVLRVAEENEVLRMGFSRWQGNWVAVVFKSLDPQAVRVVPRLRHGFTLPDLDDFLMPLRVQIESDVNESGRRVL
IQAHHAVFDGWSVDMMLSDMSSILTGSIPQPRPQFRKVLEYRHHHLGGDEEKKFWSEYLLGWHKVPFPKLVGRHL
TNKMETTRETLQLSPQLVRESVSKLGLSAQVLFQASLAFCWSAVLGANDVVIGSVTAGRTLPIEGIDRIMGPCIA
SLPLRVGMRNAASNLDVLQDIHGSNRAVMDHASLPLLEIKKLAGLQTTESLYDVLFVYQESLLTFEEKKKQLVVQ
QDHLDRLETRLLLEVEPRDGEYVLQATFHCAHFSLEFVKCFLQQFSHRLQQLLQQIDPLFSGQGILSKPQVSIYN
QDVKAFTGVPDLAAQFEMTAAKIPNDTALLFNKSPDLSAATFTLLTYQQLNNAANQVAHYLRSRLVEPNQVLAIV
MDKSPTFYISILGIAKAGCAYMPLLPTTPILRIRDVLRHANIAYCLVDNASQSALDLDQDVNTLNIESAPIGSFP
DHNLGIAADASRLAYVIYTSGTTGVPKGVAVTQGNIVSNIAYLRSIYPFSASKQSRFLQACSQAFDVSVFEIFYA
WIAGMCLCSATNDVLFSDLEESIRQFEITHLSLTPTVASIIDPTQTPGVEFLVTAGEPMTCSVLERWGDRLWQGY
GPSETTNICSVKHMTRIEHIEHLGWVFPNTSVAVVKSGTLEILPMGCVGEFCFGGDQVAQGYLNDTSRTTEKFVL
HPRLGRAYLSGDVGRMLPDGSLVILGRLDDQFKLRGQRIEAGEISGIVTGTGLASSAVTMIVRRREGAPDQLAVF
YTPRQTHAEFDRLKVDRETQGLLFSSLQSRLPLFMVPSYLVPVSIIPRTSSGKIDRRHLQTSFEELFQEELECFS
YSRQRQDDQGDWSDAELALVEVIATWAKVERGEVGRWTPFAALGIDSISAIDVSRAVSSCLKTRVPISAIMQNPS
IAQLARHLEAKVGQEAHVSSEKVDVFDLGISEDSLRACGQSVMAVEDILPCTPLQEAMLAQRSNSYCNKTLLRLR
ITADELMAFWDTMTQRHGILRTFFLTTRNTARPMAQVILKEYKTRWKEFDLYEPSFADVTHEHAECLPELLDSGK
PPLTCAIIRYRGISFFSLICHHALYDGVAMGTLWREIETLANGGALPQPVPFRHFIEKALDLPQDTRSFWANHFR
DFEPLNLFTQLAGAKISQSSHTMSLGMPLISGRTLDLDGLDRLVAPCFNTIPMRKNLMSTGQNIQLIRSFQSLNV
QMMRYQFTSVRDVQKFANCKRRGLFETVLLLQQPLQEMDESVWTLEEDSGDMDVCVVCEVVPCPNLNSLIVNMHH
DIATVSGEAASTMADIFNHVFQRLIQAPLANIEDKSDLSQQLRASLDNLIPSKEKPMHEDVGELDYEVWTDLERR
IQTVLVSLSGASADKVSRRTTIFRLGLDSINAVQVAAILRGQGFKLSASDVIECPDCESLAKRISQLLEDGQRLE
MVNLKDFGLQVKEQIGDKILQAVRIEAILPCTPVQSAMLASFLESQGDNYLNMVTYEIQTGFSVDDLLLAWKELG
RRHQMLRTGFVAIDHTYSAFAMIRQSATALEGAIDVFRGIESEAFDLDSWKEAHRIEFVQNLSTPPWKVVLIDKA
KGVSMSLLCHHALYDAHSLQGLLDGFCGILHGKSPSYPDIEPALTEILSWNLLNQGAAETWWKTMSDNTVVNKFP
LMTPLRETRKQPQTLHSTLDMRFSLLLASLQGIGVSVQAAVQAAWARVLASYVGESSVVFGVTMSGRTSEETQNT
PMPCITTVPVIAVVDESNEEAMRLMMAYNTELYKHQFVPLNKIQKWLGHTGSPLFDTLLVYQRGDDLETSVRRPF
KVVGEEARVDYAVSLEIEPGGEDGIHLCLSFSTDILPMEQASILVAQFDATLCFLASQPAASQQDLYTLRPDLFS
VVPAAMPQIKAPVDLLHQFVEMQAERQPEEAALEFVSGFEKGIPVKQVWSYRELDMFGGRVAKLLQRDTRPGDIV
AIQFDKQPEAYFAILGILKAGCAFVALDPSAPLARRQFILQDSGASCLLLDGSTHLDFETTTIIVRIDLKSLRNA
PDEQFNLKLVKPRPESTCYCLYTSGTTGTPKGCEISHENAVQAMMAFQELFRGHWQKDSRWLQFAALHFDVSVLE
QYWSWSVGITVVSAPRQVILDNLTGSINKLGITHIDLTPSLARLTHPDEVPSLCRGVFITGGEQLKQEILDSWGS
KAVIYNAYGPTEATIGVTMYPRVPVNGRPSNIGKQFLNVGSYVMVPGTETPVLRGAVGELCVSGKLVGKGYLNRP
ELTAERFPMLANFKERIYRTGDLVRLLHDGCFDFLGRADDQVKLRGQRLEIGEIDHAIRVGAASVKDVATIVVRH
KSNDKEMLVAFLVGNTSGSDEVGILADTDGLGQEARAACLERLPGYMVPTYFLRLSRMPLSANNKAELKMLRSMF
QALSHEELLKISINGSAAYSGNLDERHVEKVGRVLSKFSSVAQDAILPSSSIFDLGVDSISALRLAMLLKAEGFE
TASSALILKSPIVGDLVRAMTAAPVGASTSGLIREARQAIQACHCRHQPLVCRELGIGPADIEYIAPCSPLQQGI
LSRCMTEEASEAYFNTLELRLDENALAKRARLAWSRLVDKHAILRSCFVNTGEGYIQVALNKAPTGWKILTAETE
EEADAIMKKTRRDWMARNRHDVLEPLEFVHVCGPSRQRLFLHMFHAVYDGWSIENMRQYATALYHDRQPSQGPMF
IEALTHGPLWRLEGCRGFWMEHLRGWEPRPMPLVESSSPQVVVSASRSVPIGAFEHLRCEQNVTMQSVVLAAWTR
VLQRYMAGKTTIGVIIAGRSMELARVQDCIGPLFSTVPFFSPRLRQISWASLIRRVHEFSTCILAFQHVPLKSIQ
KWCSGGRSLFDTLFVFQREQPSAEEDEPWTMVDGPSYPDYPLAFEAVQCGDGHVKLSIVAQGRYATQSMLEEMLA
ECELGVEKARGEDAVNADLDGVVEEEATAGAAMSDGQESVMDSIDFFWTDEALLIRDEIASLASMDKERISASTS
MLQLGLDSIDVMKLAARLKKKGLELSASQIMRQQTILRMTQETRLAGHGENEDASLAHEMLAKMRPILWAQARQA
GVDVEKVESVLPSTALQEAMVAGMLQSDFAWYFNHDVLEVSEAVDLQRLRAAWEKVVEQSPILRTGFVAVEETAL
DTAYCQVVFGHEALNIETVHLDDMGEMKQLIADATERARRGAGVEKLFQLQFATLGSQRFIVLSLAHALYDGWSM
GLVYKDLEAAYRGELEARPAAGDFIAQTLTCMTSEAQGFWSNYLAGASATMISGSSQSVAADTVVLRQESAKVPL
SRVRALCTRLSVSLQALCASCWAVVAAEQTRSLDVVFGLVLAGRDGPGAESLMFPTMNTVALRCVLHGTVADLVC
YVQDGLTDVRRWQSFSLRKALTGSRPFNSLFLMQKTPDNKSSEALLRSVDGASVVDYPVCVEAEADAESACLVWR
VACHEKLLLADEVDALVDKLDVVLEYMLEQPAGNVLVFERGGVSICRLPAVEIGDEEERVVDGGEAQDGEEEHGE
WARALRQVVADVAHVAVEAVDMSLTLYHFGLDSISAIKVSMQLRKRGLFITPRELAGAPSLKQLVRLFRCSQEGS
VATQWTPPAEVSIQRLIKESGLKQEAVEAVLPATAMQIYMLSTWQNSRGALFYPALTLRGRADEVRRAWEQVVCE
TPVLRTRLW*
Coding >OphauB2|5376
ATGGATGCTCATCATCATCTTTCCAGTCTCAACCAAAATCCTGCAAAGCTTGCCGGTCCGGGCCTCTTGCACCAT
CTGGTGGGCCCGCCGAGCCAGCGTTTGGCCCTGGAGCACTCGTCGCACAACAAGACGACGTTGTACACCTATCGG
GACCTGGACGATGCCTCCGAGGCTGTCGCACAGCGCATCACTGCCGCTTGCTGCCACGCCACGCCCTCTCTTTCC
GACTTTGTAGTTCCCGTCCTTGTTTCGCAGTCTGCTCTGCTCTATATTTCCTTGCTTGGCGTGCTCAAGGCTGGA
GGCGCGTTTTGCCCCGTTGCAATCGACGCTCCACTGGAGAGAATCAGATTTATCCTTGACGATGTGTCTGCTCAA
GTCGTCGTCGTTTCCAAGGACCTGGCGTCGAGGATACCGCAGGATACTCGTCTTCAAGTAATTTGCGTCGACGAC
TTGCATTTTCGTCTTTCCAATGGCCCTGCAATCCATCGCCAGCCAGTCCCTCAAGACTTGGCCTATGTCATGTAC
ACGTCTGGCTCTACTGGAACACCAAAGGGAGTGGCCATTACTCATTTGGCCGTGACGCAAGCTCTTCTTGCTCAC
AATCGTCATGTACCTCAGTTCAACAGATTTCTTCAGTTTGCTGCGCCAACATTTGATGTGTCCGTCTTTGAAATA
TTCTTTCCCCTCTTTCGCGGCAGCACCCTTGTCTCGGTGCGCCGGCAAGAGATGCTGGATGATTTACCAGCCGTA
ATTCGCAAAATGGACGTGGACGCTTGTGAATTGACGCCTACCGTGGCTAGCAGCTTGCTGAGGAGCAGAGACGAT
GCTCCTAGTCTAAAGCTTCTCTTGACCATTGGGGAAATGCTCAAAACACCAGTTGTTCGAGAATTTGGCGCAAGC
TTGCACCGACAAGGCATCTTGTGGGCCATGTATGGTCCAACAGAGGCGACAATTCACTGCACTCTGCAGACGGCC
ATGTCGTCTGAATCGTCGACGACGAATATTGGAGTCCCGCTTGACTCGGTTTCCTGCTTCATTATAGAGCCTCTT
GAAGATTCAACAGCGAAGCCATGCGAGTTTAAAATCCTGCCAATTGGCGAGGCTGGCGAATTAGCAATTGGGGGA
CACCAACTTGCCAGGGGCTACCTAAACCGACCCGAGCAAACAGCCGCTGCCTTTATTCAATCGCCGTACGGCCGC
CTGTACCGAACTGGTGACAGGGCTCGTTTGACTGCTTCTGGAACACTTGAGTGTTTGGGCCGGCTGGTTAGTGGG
CAAGTCAAACTGCGTGGCCAACGAATCGAGCTTGGCGAAATTGAGCACGCTGTTCTAGAGACGCCAGGCTGTCAC
GATGCAGTAGCAGCTGTCGTGGATTCCAACCTTGTGGCGTTTTGTGCCGTGGATCATCACGTCACCCAAGATGCC
CTCATTTCGACTTGTGCAGAATGGCTTCCGCGCTTCATGGTTCCAGCAGAGTTTGTATTAATGCAATATTTGCCG
CGGCTTTCAAGCGGCAAAGTTGACACCAAGAAGCTCTTGTCCGACTTTGGCGAGCAACGGGCGACTTCACTAGGC
TTTGAGAGTGCTGACACACGCCTTGATTCTCATCAGCATCTTGTCCTCGAGATAGTGTCCACTATACTGGGCATT
AGAGTCAACGAAAAGATGACCATGGCTGCTGCTGGCGTAGACTCTCTAGCGGCAATCAAGCTGGCTTCTGCTCTA
AGACGACAAGGGTTTGACGCCATAGCCACGGAGCTTTTGCGACTAAAGACGCTGTCTGATCTTTGTTGCACTCTT
CTAAAGAGACCGTTTGTGGAATCCATTACTCGGGAGCTCTCAGGGGAACAAGGGCTGCGCCTTACTATTCCACCG
GTAGGGGACAGACAGCCCGCGGCAACCGACTGTCTGCCATGCACCTTTCTTCAGTCAGCAATGCTGGCCGAGACG
GTACAAGATGTAGAAATGTACTGCAACGAAATCGAATTGCAGGTCAACTCGGACATTTCGCTGGACGCTATTTGC
GCTGCTGTCCTTCGAGTAGCTGAGGAAAACGAGGTTTTGCGCATGGGATTCTCCCGATGGCAAGGAAACTGGGTC
GCCGTTGTGTTCAAATCTCTTGATCCGCAAGCCGTGCGCGTTGTGCCTCGCCTTCGACATGGATTTACTCTGCCA
GACCTGGACGACTTTTTGATGCCCTTGAGAGTCCAGATTGAGTCGGATGTGAATGAATCTGGGCGACGCGTTTTA
ATCCAGGCCCATCATGCCGTGTTTGATGGCTGGTCAGTAGACATGATGTTGTCAGACATGTCGAGTATATTGACA
GGATCCATTCCCCAACCCCGACCACAATTTCGAAAGGTCTTGGAATACCGGCATCATCATTTGGGAGGCGACGAA
GAGAAAAAGTTTTGGAGCGAGTATCTCTTGGGATGGCACAAGGTCCCCTTTCCAAAGCTGGTCGGCCGCCACCTG
ACAAACAAGATGGAGACGACAAGGGAAACATTACAACTATCGCCGCAGCTCGTACGGGAGTCTGTTTCAAAATTA
GGCCTCAGTGCTCAAGTTCTTTTTCAGGCTTCTCTAGCTTTCTGCTGGAGTGCTGTTCTCGGAGCAAACGATGTT
GTGATTGGATCCGTCACTGCTGGCAGAACCTTGCCGATTGAAGGCATTGACAGAATCATGGGTCCATGCATTGCA
TCTCTTCCTCTTCGAGTTGGTATGAGAAACGCGGCGTCTAATCTGGATGTCCTGCAAGACATTCACGGGAGCAAC
CGAGCCGTCATGGATCACGCATCTCTGCCGCTCTTGGAAATCAAGAAGCTGGCAGGTTTGCAAACGACAGAGAGT
CTATACGACGTGCTGTTTGTCTACCAAGAGTCTTTGCTTACTTTTGAGGAAAAGAAGAAGCAATTGGTTGTGCAG
CAAGACCATCTCGATCGCCTAGAGACTAGACTCCTCCTAGAAGTCGAACCCCGAGATGGAGAGTATGTGCTGCAA
GCAACATTTCACTGTGCACACTTTTCATTGGAATTTGTCAAGTGTTTTTTGCAGCAGTTTAGCCATAGGCTTCAA
CAGCTTCTTCAGCAAATTGACCCCTTGTTTTCTGGGCAGGGCATCTTGTCAAAACCTCAGGTGTCTATTTACAAC
CAAGATGTAAAAGCCTTTACTGGGGTTCCCGACTTGGCCGCCCAGTTCGAGATGACGGCAGCAAAGATACCAAAT
GACACGGCTCTTTTATTCAACAAGTCTCCAGATTTATCGGCGGCTACTTTTACCCTGTTGACATATCAGCAGCTG
AACAATGCTGCTAATCAGGTGGCACATTATTTACGGAGCCGTCTTGTCGAGCCGAACCAGGTTCTAGCCATTGTC
ATGGACAAATCACCGACCTTTTACATTTCCATATTGGGCATCGCAAAGGCAGGATGTGCCTACATGCCACTTTTA
CCGACGACTCCAATTTTGCGGATTCGCGACGTGCTGAGACATGCAAACATCGCATACTGTCTAGTAGACAACGCC
TCGCAATCCGCTCTCGATCTCGATCAAGATGTCAATACTCTAAACATCGAAAGCGCACCTATAGGCTCTTTTCCT
GACCACAACTTGGGCATCGCTGCAGATGCCTCTCGTCTAGCCTATGTGATTTATACTTCTGGGACCACTGGAGTT
CCCAAAGGCGTTGCCGTAACTCAAGGCAACATTGTCAGCAACATTGCATATTTGCGATCGATATACCCCTTTTCA
GCAAGCAAGCAGTCTCGATTCCTGCAAGCCTGTTCTCAAGCTTTTGATGTTTCAGTTTTTGAGATATTTTATGCA
TGGATTGCGGGCATGTGTCTCTGTTCAGCGACAAATGACGTCCTCTTTTCTGACTTGGAAGAGTCTATTCGACAA
TTCGAAATCACACATTTAAGCCTGACACCAACTGTTGCGTCAATTATTGATCCTACTCAAACTCCGGGGGTTGAG
TTTCTCGTCACTGCAGGCGAGCCAATGACTTGTTCAGTTCTTGAGCGCTGGGGAGATCGGTTGTGGCAGGGATAC
GGGCCCTCTGAGACGACAAACATATGCAGCGTCAAGCACATGACTAGAATTGAACATATTGAGCATCTCGGCTGG
GTATTTCCCAATACATCGGTGGCTGTTGTGAAGTCGGGAACTCTCGAGATTCTTCCGATGGGATGTGTCGGTGAA
TTCTGCTTTGGCGGCGACCAGGTGGCTCAAGGATACCTCAACGACACTAGTCGCACAACTGAAAAGTTTGTTTTG
CACCCTCGGCTTGGGAGGGCATATTTATCAGGAGATGTGGGAAGAATGCTTCCCGACGGCTCCTTGGTAATTCTC
GGCCGGCTAGATGACCAGTTCAAGTTGCGGGGTCAGCGGATTGAGGCTGGCGAGATTAGCGGAATTGTGACGGGG
ACGGGACTTGCCTCATCTGCCGTTACTATGATTGTTCGGCGGAGAGAGGGAGCGCCTGATCAGCTTGCAGTCTTT
TACACGCCTCGCCAAACACACGCCGAGTTTGACCGTTTAAAAGTGGATCGAGAAACTCAGGGCCTGCTGTTTAGC
AGTTTACAGTCTCGTTTGCCTTTATTCATGGTGCCTTCTTATCTGGTTCCAGTGTCTATTATTCCTCGCACATCC
AGCGGCAAGATTGACCGACGTCATCTCCAGACTAGCTTTGAGGAATTATTCCAGGAGGAACTAGAATGTTTTTCT
TATTCCAGGCAGAGACAAGATGACCAAGGAGACTGGTCAGATGCCGAATTGGCTCTCGTCGAGGTCATTGCAACG
TGGGCCAAGGTGGAAAGAGGGGAAGTCGGAAGGTGGACTCCGTTTGCAGCCCTTGGGATTGACTCCATTTCAGCC
ATTGACGTCTCACGAGCCGTGAGCTCCTGTTTAAAAACCCGTGTCCCTATATCAGCCATTATGCAGAACCCGTCT
ATTGCGCAACTGGCAAGACATCTTGAAGCAAAGGTTGGACAAGAGGCTCATGTCAGTTCTGAAAAAGTCGACGTT
TTCGACCTTGGAATTTCGGAAGACAGCCTAAGAGCTTGTGGCCAGAGTGTCATGGCTGTGGAGGACATTTTGCCA
TGCACGCCACTACAGGAGGCCATGTTGGCCCAAAGATCAAACAGTTACTGTAACAAGACACTGCTGCGCCTACGA
ATCACGGCTGATGAACTAATGGCATTTTGGGACACAATGACGCAAAGGCATGGTATCCTCAGGACCTTTTTCTTG
ACGACTAGAAACACTGCACGGCCAATGGCTCAGGTTATTCTTAAAGAGTACAAGACACGGTGGAAAGAATTCGAC
CTCTATGAACCTTCATTTGCAGACGTGACGCACGAGCATGCCGAATGTTTACCTGAACTTTTGGACTCTGGAAAG
CCTCCACTAACGTGTGCCATTATACGGTATAGAGGAATTTCCTTCTTCTCTCTCATCTGCCACCACGCTCTATAT
GACGGTGTCGCAATGGGAACTCTCTGGAGAGAGATTGAAACTCTGGCCAATGGCGGTGCTCTGCCGCAACCTGTG
CCTTTTAGACACTTTATCGAAAAGGCGCTAGACCTTCCACAAGACACAAGGAGCTTTTGGGCCAATCATTTTCGC
GATTTCGAACCTTTGAACCTGTTTACGCAGCTGGCAGGGGCAAAGATTAGCCAATCCAGTCATACCATGTCTCTG
GGAATGCCACTAATCAGCGGCCGGACTCTGGACTTGGATGGACTGGACCGCCTGGTTGCGCCTTGCTTCAACACT
ATACCAATGCGCAAAAATTTGATGAGCACGGGCCAGAATATTCAACTCATTCGAAGTTTTCAGTCCTTGAATGTG
CAAATGATGCGCTATCAGTTTACTTCGGTACGGGATGTCCAAAAGTTTGCCAACTGTAAGAGAAGAGGGCTTTTT
GAAACGGTACTCTTGCTGCAGCAACCGTTGCAAGAAATGGATGAGAGTGTTTGGACGCTAGAGGAAGATTCGGGG
GATATGGATGTTTGCGTGGTTTGCGAAGTGGTGCCCTGTCCGAACCTCAACTCGTTGATTGTCAATATGCATCAC
GACATTGCTACAGTCTCGGGAGAGGCTGCGTCGACAATGGCAGACATTTTCAACCATGTGTTTCAACGTCTAATA
CAGGCTCCCCTGGCGAATATAGAGGATAAGAGTGACCTCTCTCAGCAGTTGAGAGCAAGTCTTGATAATCTCATA
CCGAGCAAGGAGAAACCGATGCACGAGGATGTTGGAGAATTAGACTACGAGGTTTGGACTGACCTCGAACGAAGG
ATTCAAACTGTCCTTGTGAGTTTGTCAGGGGCATCGGCAGACAAGGTTTCACGGCGCACAACCATTTTTAGACTT
GGTTTGGACAGTATCAATGCCGTGCAGGTTGCAGCCATTTTGAGAGGTCAGGGCTTCAAGTTGTCCGCTTCGGAT
GTCATTGAATGTCCGGATTGCGAATCTTTGGCCAAGCGGATCTCTCAGCTCTTGGAAGATGGCCAGAGACTTGAA
ATGGTGAATCTCAAGGACTTTGGGTTGCAGGTCAAGGAACAAATTGGCGACAAGATTTTACAGGCTGTTCGAATC
GAAGCCATTTTACCTTGCACTCCTGTGCAGTCTGCCATGCTGGCGTCGTTTCTTGAGTCACAAGGCGACAATTAC
TTGAACATGGTCACGTACGAAATACAAACCGGCTTTAGTGTGGACGACTTGCTCCTCGCATGGAAAGAATTGGGT
CGTCGACATCAGATGCTTCGGACAGGATTCGTGGCCATTGACCACACGTATAGCGCGTTTGCCATGATTCGGCAG
TCAGCAACTGCTCTTGAGGGCGCGATTGATGTTTTCCGGGGCATCGAGTCTGAAGCCTTTGATTTGGACTCTTGG
AAAGAAGCACACCGCATTGAATTTGTTCAGAATTTGTCCACTCCGCCTTGGAAGGTTGTCCTGATTGACAAGGCA
AAGGGCGTATCAATGTCGTTGTTGTGTCATCACGCACTATATGATGCTCATTCTCTGCAAGGCCTTTTGGACGGC
TTCTGCGGTATCCTGCACGGAAAAAGCCCGTCTTATCCAGATATTGAGCCTGCACTGACTGAAATACTCTCTTGG
AACCTGCTCAATCAAGGCGCCGCTGAGACGTGGTGGAAGACAATGTCGGATAATACTGTGGTGAACAAGTTTCCT
CTAATGACCCCGCTGCGCGAGACGCGAAAACAGCCTCAAACCTTGCACAGCACATTGGACATGAGATTCAGTTTG
TTGCTAGCGTCATTGCAAGGCATTGGTGTTTCCGTTCAGGCCGCAGTTCAGGCCGCCTGGGCTCGCGTACTGGCC
TCGTATGTTGGCGAGAGCTCTGTTGTTTTTGGGGTTACCATGTCTGGCCGTACCAGTGAGGAGACGCAAAACACA
CCAATGCCGTGCATAACAACTGTTCCTGTCATAGCCGTTGTTGACGAGTCGAATGAGGAGGCGATGAGACTAATG
ATGGCATACAATACTGAGTTGTATAAGCATCAGTTTGTGCCCCTGAATAAGATTCAAAAATGGCTGGGCCATACT
GGGAGCCCTCTTTTCGATACGCTGCTCGTCTACCAAAGGGGAGATGACCTCGAGACGTCTGTCCGGCGACCGTTT
AAAGTGGTGGGGGAAGAGGCAAGGGTAGACTATGCCGTGTCGTTGGAAATTGAACCAGGAGGAGAAGACGGGATT
CATCTGTGCCTGTCCTTTTCCACAGACATATTACCTATGGAGCAAGCAAGCATTCTGGTGGCGCAGTTTGATGCT
ACACTCTGTTTTCTTGCCTCGCAACCGGCTGCAAGTCAGCAAGACTTGTACACGCTGAGGCCAGATCTCTTTTCC
GTCGTACCTGCGGCAATGCCTCAAATCAAGGCGCCTGTTGACTTGCTGCACCAGTTTGTCGAGATGCAAGCAGAA
CGCCAACCTGAAGAAGCGGCTCTTGAGTTTGTGAGCGGCTTCGAAAAGGGAATTCCCGTCAAGCAAGTCTGGAGC
TATCGGGAACTAGACATGTTTGGAGGCCGAGTGGCGAAGCTGTTGCAGCGTGATACCAGGCCCGGAGACATTGTG
GCAATTCAGTTTGACAAGCAGCCCGAAGCCTATTTTGCCATTCTCGGGATCCTCAAGGCTGGCTGCGCCTTTGTT
GCGCTCGATCCTAGTGCTCCACTTGCGCGCAGACAGTTCATCTTGCAGGACTCTGGGGCGAGTTGTCTTTTGCTA
GATGGCTCTACACACCTTGACTTTGAAACGACGACTATTATTGTTCGCATAGACTTGAAATCTTTGCGAAATGCT
CCGGATGAGCAGTTTAATCTGAAACTCGTGAAGCCGAGACCTGAAAGCACATGCTACTGCCTATATACATCTGGA
ACAACTGGAACCCCAAAGGGATGTGAAATATCTCACGAAAACGCAGTGCAGGCAATGATGGCATTTCAGGAACTT
TTTAGAGGCCATTGGCAAAAGGACTCGCGGTGGCTACAGTTTGCAGCTCTTCATTTTGACGTTTCAGTCTTGGAG
CAGTACTGGAGCTGGTCAGTGGGCATCACTGTCGTTTCAGCACCACGCCAAGTGATACTGGATAATCTTACTGGA
TCCATCAACAAGCTTGGCATCACTCACATTGACTTGACGCCGAGCTTGGCAAGACTGACACATCCGGATGAAGTG
CCGAGCTTGTGTCGAGGCGTATTCATCACGGGTGGAGAGCAGCTCAAGCAAGAGATTCTTGACAGCTGGGGATCC
AAGGCAGTCATTTACAATGCATATGGCCCCACGGAAGCTACAATTGGAGTGACCATGTACCCCCGCGTGCCTGTC
AATGGGCGGCCGAGCAATATTGGCAAGCAGTTTCTCAATGTTGGCTCATATGTAATGGTTCCCGGCACCGAGACT
CCAGTTCTTCGAGGTGCAGTTGGCGAGCTTTGCGTGTCGGGGAAGTTGGTGGGCAAGGGATATTTAAACCGGCCA
GAGCTGACGGCAGAAAGATTTCCAATGCTTGCAAATTTTAAGGAGAGAATCTACCGCACTGGCGATTTGGTGCGC
CTTCTTCATGACGGGTGCTTTGACTTTCTCGGACGCGCAGATGATCAAGTCAAGCTTCGAGGACAGCGATTGGAG
ATTGGGGAGATTGATCATGCGATTCGTGTGGGAGCAGCTAGTGTCAAGGACGTGGCGACGATTGTTGTGCGACAC
AAGTCTAATGACAAGGAAATGCTGGTGGCATTCTTGGTTGGAAATACGAGCGGCTCTGACGAGGTTGGAATTCTT
GCAGACACGGATGGGCTGGGGCAAGAGGCCAGAGCGGCGTGCCTTGAACGGCTGCCGGGATACATGGTGCCAACA
TATTTCCTCCGTCTGTCCCGCATGCCTCTTTCAGCGAACAACAAGGCAGAGCTCAAGATGCTGCGAAGCATGTTT
CAAGCTCTCTCGCATGAGGAGTTGCTAAAAATTTCGATTAATGGCAGCGCGGCATATAGTGGCAACCTGGACGAG
CGTCATGTGGAAAAGGTTGGCCGTGTGCTTTCAAAGTTTTCGAGCGTTGCACAAGATGCGATTTTGCCGTCGAGC
AGTATATTTGACCTTGGAGTCGACTCTATTAGCGCGTTGAGACTTGCCATGCTGCTCAAGGCTGAAGGATTCGAG
ACTGCATCGTCGGCTTTGATACTCAAATCGCCCATTGTTGGCGACCTTGTCAGAGCAATGACTGCCGCACCAGTC
GGCGCATCGACGTCTGGCTTGATTCGGGAAGCCAGACAGGCGATACAGGCCTGCCATTGCAGACATCAGCCTCTT
GTCTGCCGCGAGCTGGGCATTGGACCGGCAGACATTGAATACATTGCACCATGTTCGCCGTTACAGCAGGGCATA
TTGTCGAGATGCATGACTGAAGAAGCTTCCGAAGCATACTTTAATACTTTGGAGCTACGACTTGATGAGAATGCC
TTGGCAAAACGAGCTCGGCTAGCATGGAGTCGACTGGTTGACAAGCATGCCATTTTGAGGTCTTGTTTTGTCAAT
ACTGGCGAGGGGTATATTCAAGTGGCGCTGAACAAGGCTCCAACTGGCTGGAAGATTTTGACTGCAGAGACTGAG
GAGGAAGCTGATGCCATTATGAAGAAGACGCGACGAGACTGGATGGCAAGGAACCGGCATGACGTCTTGGAGCCG
CTGGAGTTTGTGCACGTTTGTGGACCAAGCCGACAAAGATTGTTTTTGCACATGTTTCATGCGGTATATGACGGA
TGGAGCATTGAAAACATGAGGCAGTATGCCACTGCTCTGTACCACGACCGGCAGCCAAGCCAAGGACCCATGTTT
ATCGAAGCACTGACTCACGGGCCTTTATGGAGACTTGAAGGCTGTAGAGGATTCTGGATGGAGCATTTACGGGGC
TGGGAGCCGCGCCCAATGCCTCTTGTCGAGTCGTCCTCTCCGCAAGTCGTCGTGTCTGCATCGCGAAGCGTTCCC
ATTGGCGCGTTTGAGCATCTGCGCTGTGAGCAAAATGTCACTATGCAGTCTGTCGTACTGGCAGCGTGGACCAGG
GTCTTGCAGCGATATATGGCAGGGAAGACGACGATTGGGGTCATCATTGCAGGCCGGTCAATGGAATTGGCTAGA
GTGCAAGATTGCATTGGTCCCTTGTTCAGCACGGTGCCCTTTTTCAGTCCTAGGCTGCGGCAAATAAGCTGGGCT
TCACTGATACGCCGCGTTCACGAATTCAGTACATGTATTCTCGCATTTCAACACGTGCCGCTCAAGAGCATACAA
AAGTGGTGCTCTGGGGGTCGTTCACTGTTTGACACGTTGTTTGTGTTTCAACGAGAGCAGCCTAGTGCAGAGGAA
GACGAGCCGTGGACAATGGTGGACGGGCCGAGCTATCCAGACTATCCGCTTGCTTTTGAAGCGGTGCAGTGTGGC
GATGGGCATGTCAAGCTTTCGATTGTTGCTCAAGGCCGCTATGCCACACAGAGTATGCTTGAGGAGATGCTTGCC
GAGTGTGAATTGGGTGTGGAAAAGGCACGGGGGGAAGACGCGGTGAATGCTGACTTGGATGGGGTCGTTGAAGAA
GAGGCAACAGCAGGAGCGGCGATGAGTGACGGACAAGAGTCGGTCATGGATTCCATCGACTTTTTCTGGACGGAT
GAAGCGCTTTTAATCAGGGACGAGATTGCCAGTCTGGCCAGCATGGACAAGGAGAGAATAAGTGCGTCGACGTCG
ATGCTGCAACTGGGTCTTGACAGCATTGATGTCATGAAGCTGGCTGCCAGGTTGAAGAAGAAGGGCCTTGAGCTG
TCAGCATCGCAGATTATGCGCCAGCAGACCATTTTGCGCATGACGCAAGAGACACGGCTGGCCGGCCATGGAGAG
AATGAAGATGCAAGTCTTGCACATGAGATGTTGGCAAAGATGAGGCCGATTCTATGGGCTCAGGCGAGGCAAGCT
GGAGTTGATGTGGAAAAGGTGGAATCAGTTTTGCCGTCGACGGCCCTCCAAGAAGCCATGGTGGCAGGCATGTTG
CAATCAGACTTTGCGTGGTACTTTAACCACGATGTGCTCGAGGTGTCTGAAGCAGTCGATTTGCAGAGACTGCGA
GCCGCGTGGGAAAAGGTGGTTGAGCAATCTCCCATTTTGCGGACGGGCTTTGTCGCTGTGGAAGAGACTGCTCTA
GACACTGCATACTGTCAAGTGGTGTTTGGACACGAGGCCTTGAATATCGAGACTGTGCATCTAGACGACATGGGA
GAGATGAAGCAGCTTATTGCGGATGCGACTGAGCGAGCCAGACGAGGAGCTGGTGTTGAGAAGCTGTTTCAGCTA
CAGTTTGCAACACTTGGCAGTCAAAGATTTATCGTGCTTTCACTTGCTCATGCGCTGTATGATGGGTGGTCGATG
GGCCTCGTGTACAAGGATCTCGAGGCGGCGTACCGAGGCGAGCTGGAAGCAAGGCCGGCAGCGGGAGACTTTATT
GCGCAGACGCTTACATGCATGACGAGTGAGGCGCAAGGATTCTGGAGCAACTACCTGGCTGGTGCATCTGCAACC
ATGATTTCTGGATCAAGTCAGTCGGTGGCGGCAGACACTGTTGTGCTCAGACAAGAGTCGGCCAAAGTGCCGCTC
TCCCGCGTTCGGGCACTTTGCACAAGACTGTCAGTCAGTCTCCAGGCTCTCTGTGCCTCGTGCTGGGCCGTGGTG
GCGGCTGAGCAGACGCGGTCTCTGGATGTCGTCTTTGGGCTGGTGCTTGCGGGCAGAGATGGGCCGGGTGCGGAG
AGTCTAATGTTTCCAACCATGAATACGGTTGCCTTGCGCTGCGTCTTGCACGGCACCGTGGCGGATCTCGTGTGC
TACGTGCAAGACGGCTTGACTGATGTGCGCCGGTGGCAAAGCTTTTCTCTACGCAAGGCATTGACGGGTTCGAGG
CCGTTTAACTCGCTCTTTTTGATGCAAAAGACACCAGACAATAAATCGAGTGAGGCGCTGCTGCGTTCGGTTGAT
GGAGCATCTGTTGTTGATTATCCGGTATGTGTCGAGGCTGAGGCTGATGCCGAGTCGGCATGTTTGGTGTGGCGG
GTTGCCTGTCATGAGAAGCTCTTGTTGGCGGACGAGGTGGATGCGCTGGTGGACAAGCTTGACGTCGTCTTGGAG
TATATGCTTGAGCAACCAGCGGGCAATGTCTTGGTGTTTGAGCGTGGGGGCGTGTCGATTTGCAGGCTGCCTGCT
GTGGAGATTGGTGATGAGGAGGAGAGAGTAGTTGATGGCGGCGAGGCGCAAGATGGAGAGGAGGAGCATGGCGAG
TGGGCAAGGGCGTTGAGGCAAGTGGTGGCGGATGTGGCGCATGTTGCCGTGGAAGCGGTCGACATGTCGCTGACG
CTGTACCACTTTGGCCTCGACTCAATTAGCGCCATCAAGGTGTCGATGCAGCTGCGCAAAAGGGGGCTTTTTATC
ACGCCGCGAGAACTAGCTGGCGCACCGAGTCTGAAGCAGCTTGTCCGTCTTTTCCGTTGCAGCCAAGAGGGCAGC
GTGGCAACGCAGTGGACACCCCCTGCCGAGGTGTCAATCCAGAGGCTTATAAAGGAGAGCGGGCTAAAGCAAGAA
GCAGTCGAGGCAGTGCTGCCCGCCACAGCAATGCAGATATACATGCTGTCAACGTGGCAAAACTCGCGCGGGGCA
CTGTTTTACCCAGCCTTGACGCTGCGGGGAAGGGCAGACGAGGTGCGGCGGGCGTGGGAGCAAGTTGTTTGCGAG
ACGCCGGTGCTGCGGACGCGATTGTGGTGA
Transcript >OphauB2|5376
ATGGATGCTCATCATCATCTTTCCAGTCTCAACCAAAATCCTGCAAAGCTTGCCGGTCCGGGCCTCTTGCACCAT
CTGGTGGGCCCGCCGAGCCAGCGTTTGGCCCTGGAGCACTCGTCGCACAACAAGACGACGTTGTACACCTATCGG
GACCTGGACGATGCCTCCGAGGCTGTCGCACAGCGCATCACTGCCGCTTGCTGCCACGCCACGCCCTCTCTTTCC
GACTTTGTAGTTCCCGTCCTTGTTTCGCAGTCTGCTCTGCTCTATATTTCCTTGCTTGGCGTGCTCAAGGCTGGA
GGCGCGTTTTGCCCCGTTGCAATCGACGCTCCACTGGAGAGAATCAGATTTATCCTTGACGATGTGTCTGCTCAA
GTCGTCGTCGTTTCCAAGGACCTGGCGTCGAGGATACCGCAGGATACTCGTCTTCAAGTAATTTGCGTCGACGAC
TTGCATTTTCGTCTTTCCAATGGCCCTGCAATCCATCGCCAGCCAGTCCCTCAAGACTTGGCCTATGTCATGTAC
ACGTCTGGCTCTACTGGAACACCAAAGGGAGTGGCCATTACTCATTTGGCCGTGACGCAAGCTCTTCTTGCTCAC
AATCGTCATGTACCTCAGTTCAACAGATTTCTTCAGTTTGCTGCGCCAACATTTGATGTGTCCGTCTTTGAAATA
TTCTTTCCCCTCTTTCGCGGCAGCACCCTTGTCTCGGTGCGCCGGCAAGAGATGCTGGATGATTTACCAGCCGTA
ATTCGCAAAATGGACGTGGACGCTTGTGAATTGACGCCTACCGTGGCTAGCAGCTTGCTGAGGAGCAGAGACGAT
GCTCCTAGTCTAAAGCTTCTCTTGACCATTGGGGAAATGCTCAAAACACCAGTTGTTCGAGAATTTGGCGCAAGC
TTGCACCGACAAGGCATCTTGTGGGCCATGTATGGTCCAACAGAGGCGACAATTCACTGCACTCTGCAGACGGCC
ATGTCGTCTGAATCGTCGACGACGAATATTGGAGTCCCGCTTGACTCGGTTTCCTGCTTCATTATAGAGCCTCTT
GAAGATTCAACAGCGAAGCCATGCGAGTTTAAAATCCTGCCAATTGGCGAGGCTGGCGAATTAGCAATTGGGGGA
CACCAACTTGCCAGGGGCTACCTAAACCGACCCGAGCAAACAGCCGCTGCCTTTATTCAATCGCCGTACGGCCGC
CTGTACCGAACTGGTGACAGGGCTCGTTTGACTGCTTCTGGAACACTTGAGTGTTTGGGCCGGCTGGTTAGTGGG
CAAGTCAAACTGCGTGGCCAACGAATCGAGCTTGGCGAAATTGAGCACGCTGTTCTAGAGACGCCAGGCTGTCAC
GATGCAGTAGCAGCTGTCGTGGATTCCAACCTTGTGGCGTTTTGTGCCGTGGATCATCACGTCACCCAAGATGCC
CTCATTTCGACTTGTGCAGAATGGCTTCCGCGCTTCATGGTTCCAGCAGAGTTTGTATTAATGCAATATTTGCCG
CGGCTTTCAAGCGGCAAAGTTGACACCAAGAAGCTCTTGTCCGACTTTGGCGAGCAACGGGCGACTTCACTAGGC
TTTGAGAGTGCTGACACACGCCTTGATTCTCATCAGCATCTTGTCCTCGAGATAGTGTCCACTATACTGGGCATT
AGAGTCAACGAAAAGATGACCATGGCTGCTGCTGGCGTAGACTCTCTAGCGGCAATCAAGCTGGCTTCTGCTCTA
AGACGACAAGGGTTTGACGCCATAGCCACGGAGCTTTTGCGACTAAAGACGCTGTCTGATCTTTGTTGCACTCTT
CTAAAGAGACCGTTTGTGGAATCCATTACTCGGGAGCTCTCAGGGGAACAAGGGCTGCGCCTTACTATTCCACCG
GTAGGGGACAGACAGCCCGCGGCAACCGACTGTCTGCCATGCACCTTTCTTCAGTCAGCAATGCTGGCCGAGACG
GTACAAGATGTAGAAATGTACTGCAACGAAATCGAATTGCAGGTCAACTCGGACATTTCGCTGGACGCTATTTGC
GCTGCTGTCCTTCGAGTAGCTGAGGAAAACGAGGTTTTGCGCATGGGATTCTCCCGATGGCAAGGAAACTGGGTC
GCCGTTGTGTTCAAATCTCTTGATCCGCAAGCCGTGCGCGTTGTGCCTCGCCTTCGACATGGATTTACTCTGCCA
GACCTGGACGACTTTTTGATGCCCTTGAGAGTCCAGATTGAGTCGGATGTGAATGAATCTGGGCGACGCGTTTTA
ATCCAGGCCCATCATGCCGTGTTTGATGGCTGGTCAGTAGACATGATGTTGTCAGACATGTCGAGTATATTGACA
GGATCCATTCCCCAACCCCGACCACAATTTCGAAAGGTCTTGGAATACCGGCATCATCATTTGGGAGGCGACGAA
GAGAAAAAGTTTTGGAGCGAGTATCTCTTGGGATGGCACAAGGTCCCCTTTCCAAAGCTGGTCGGCCGCCACCTG
ACAAACAAGATGGAGACGACAAGGGAAACATTACAACTATCGCCGCAGCTCGTACGGGAGTCTGTTTCAAAATTA
GGCCTCAGTGCTCAAGTTCTTTTTCAGGCTTCTCTAGCTTTCTGCTGGAGTGCTGTTCTCGGAGCAAACGATGTT
GTGATTGGATCCGTCACTGCTGGCAGAACCTTGCCGATTGAAGGCATTGACAGAATCATGGGTCCATGCATTGCA
TCTCTTCCTCTTCGAGTTGGTATGAGAAACGCGGCGTCTAATCTGGATGTCCTGCAAGACATTCACGGGAGCAAC
CGAGCCGTCATGGATCACGCATCTCTGCCGCTCTTGGAAATCAAGAAGCTGGCAGGTTTGCAAACGACAGAGAGT
CTATACGACGTGCTGTTTGTCTACCAAGAGTCTTTGCTTACTTTTGAGGAAAAGAAGAAGCAATTGGTTGTGCAG
CAAGACCATCTCGATCGCCTAGAGACTAGACTCCTCCTAGAAGTCGAACCCCGAGATGGAGAGTATGTGCTGCAA
GCAACATTTCACTGTGCACACTTTTCATTGGAATTTGTCAAGTGTTTTTTGCAGCAGTTTAGCCATAGGCTTCAA
CAGCTTCTTCAGCAAATTGACCCCTTGTTTTCTGGGCAGGGCATCTTGTCAAAACCTCAGGTGTCTATTTACAAC
CAAGATGTAAAAGCCTTTACTGGGGTTCCCGACTTGGCCGCCCAGTTCGAGATGACGGCAGCAAAGATACCAAAT
GACACGGCTCTTTTATTCAACAAGTCTCCAGATTTATCGGCGGCTACTTTTACCCTGTTGACATATCAGCAGCTG
AACAATGCTGCTAATCAGGTGGCACATTATTTACGGAGCCGTCTTGTCGAGCCGAACCAGGTTCTAGCCATTGTC
ATGGACAAATCACCGACCTTTTACATTTCCATATTGGGCATCGCAAAGGCAGGATGTGCCTACATGCCACTTTTA
CCGACGACTCCAATTTTGCGGATTCGCGACGTGCTGAGACATGCAAACATCGCATACTGTCTAGTAGACAACGCC
TCGCAATCCGCTCTCGATCTCGATCAAGATGTCAATACTCTAAACATCGAAAGCGCACCTATAGGCTCTTTTCCT
GACCACAACTTGGGCATCGCTGCAGATGCCTCTCGTCTAGCCTATGTGATTTATACTTCTGGGACCACTGGAGTT
CCCAAAGGCGTTGCCGTAACTCAAGGCAACATTGTCAGCAACATTGCATATTTGCGATCGATATACCCCTTTTCA
GCAAGCAAGCAGTCTCGATTCCTGCAAGCCTGTTCTCAAGCTTTTGATGTTTCAGTTTTTGAGATATTTTATGCA
TGGATTGCGGGCATGTGTCTCTGTTCAGCGACAAATGACGTCCTCTTTTCTGACTTGGAAGAGTCTATTCGACAA
TTCGAAATCACACATTTAAGCCTGACACCAACTGTTGCGTCAATTATTGATCCTACTCAAACTCCGGGGGTTGAG
TTTCTCGTCACTGCAGGCGAGCCAATGACTTGTTCAGTTCTTGAGCGCTGGGGAGATCGGTTGTGGCAGGGATAC
GGGCCCTCTGAGACGACAAACATATGCAGCGTCAAGCACATGACTAGAATTGAACATATTGAGCATCTCGGCTGG
GTATTTCCCAATACATCGGTGGCTGTTGTGAAGTCGGGAACTCTCGAGATTCTTCCGATGGGATGTGTCGGTGAA
TTCTGCTTTGGCGGCGACCAGGTGGCTCAAGGATACCTCAACGACACTAGTCGCACAACTGAAAAGTTTGTTTTG
CACCCTCGGCTTGGGAGGGCATATTTATCAGGAGATGTGGGAAGAATGCTTCCCGACGGCTCCTTGGTAATTCTC
GGCCGGCTAGATGACCAGTTCAAGTTGCGGGGTCAGCGGATTGAGGCTGGCGAGATTAGCGGAATTGTGACGGGG
ACGGGACTTGCCTCATCTGCCGTTACTATGATTGTTCGGCGGAGAGAGGGAGCGCCTGATCAGCTTGCAGTCTTT
TACACGCCTCGCCAAACACACGCCGAGTTTGACCGTTTAAAAGTGGATCGAGAAACTCAGGGCCTGCTGTTTAGC
AGTTTACAGTCTCGTTTGCCTTTATTCATGGTGCCTTCTTATCTGGTTCCAGTGTCTATTATTCCTCGCACATCC
AGCGGCAAGATTGACCGACGTCATCTCCAGACTAGCTTTGAGGAATTATTCCAGGAGGAACTAGAATGTTTTTCT
TATTCCAGGCAGAGACAAGATGACCAAGGAGACTGGTCAGATGCCGAATTGGCTCTCGTCGAGGTCATTGCAACG
TGGGCCAAGGTGGAAAGAGGGGAAGTCGGAAGGTGGACTCCGTTTGCAGCCCTTGGGATTGACTCCATTTCAGCC
ATTGACGTCTCACGAGCCGTGAGCTCCTGTTTAAAAACCCGTGTCCCTATATCAGCCATTATGCAGAACCCGTCT
ATTGCGCAACTGGCAAGACATCTTGAAGCAAAGGTTGGACAAGAGGCTCATGTCAGTTCTGAAAAAGTCGACGTT
TTCGACCTTGGAATTTCGGAAGACAGCCTAAGAGCTTGTGGCCAGAGTGTCATGGCTGTGGAGGACATTTTGCCA
TGCACGCCACTACAGGAGGCCATGTTGGCCCAAAGATCAAACAGTTACTGTAACAAGACACTGCTGCGCCTACGA
ATCACGGCTGATGAACTAATGGCATTTTGGGACACAATGACGCAAAGGCATGGTATCCTCAGGACCTTTTTCTTG
ACGACTAGAAACACTGCACGGCCAATGGCTCAGGTTATTCTTAAAGAGTACAAGACACGGTGGAAAGAATTCGAC
CTCTATGAACCTTCATTTGCAGACGTGACGCACGAGCATGCCGAATGTTTACCTGAACTTTTGGACTCTGGAAAG
CCTCCACTAACGTGTGCCATTATACGGTATAGAGGAATTTCCTTCTTCTCTCTCATCTGCCACCACGCTCTATAT
GACGGTGTCGCAATGGGAACTCTCTGGAGAGAGATTGAAACTCTGGCCAATGGCGGTGCTCTGCCGCAACCTGTG
CCTTTTAGACACTTTATCGAAAAGGCGCTAGACCTTCCACAAGACACAAGGAGCTTTTGGGCCAATCATTTTCGC
GATTTCGAACCTTTGAACCTGTTTACGCAGCTGGCAGGGGCAAAGATTAGCCAATCCAGTCATACCATGTCTCTG
GGAATGCCACTAATCAGCGGCCGGACTCTGGACTTGGATGGACTGGACCGCCTGGTTGCGCCTTGCTTCAACACT
ATACCAATGCGCAAAAATTTGATGAGCACGGGCCAGAATATTCAACTCATTCGAAGTTTTCAGTCCTTGAATGTG
CAAATGATGCGCTATCAGTTTACTTCGGTACGGGATGTCCAAAAGTTTGCCAACTGTAAGAGAAGAGGGCTTTTT
GAAACGGTACTCTTGCTGCAGCAACCGTTGCAAGAAATGGATGAGAGTGTTTGGACGCTAGAGGAAGATTCGGGG
GATATGGATGTTTGCGTGGTTTGCGAAGTGGTGCCCTGTCCGAACCTCAACTCGTTGATTGTCAATATGCATCAC
GACATTGCTACAGTCTCGGGAGAGGCTGCGTCGACAATGGCAGACATTTTCAACCATGTGTTTCAACGTCTAATA
CAGGCTCCCCTGGCGAATATAGAGGATAAGAGTGACCTCTCTCAGCAGTTGAGAGCAAGTCTTGATAATCTCATA
CCGAGCAAGGAGAAACCGATGCACGAGGATGTTGGAGAATTAGACTACGAGGTTTGGACTGACCTCGAACGAAGG
ATTCAAACTGTCCTTGTGAGTTTGTCAGGGGCATCGGCAGACAAGGTTTCACGGCGCACAACCATTTTTAGACTT
GGTTTGGACAGTATCAATGCCGTGCAGGTTGCAGCCATTTTGAGAGGTCAGGGCTTCAAGTTGTCCGCTTCGGAT
GTCATTGAATGTCCGGATTGCGAATCTTTGGCCAAGCGGATCTCTCAGCTCTTGGAAGATGGCCAGAGACTTGAA
ATGGTGAATCTCAAGGACTTTGGGTTGCAGGTCAAGGAACAAATTGGCGACAAGATTTTACAGGCTGTTCGAATC
GAAGCCATTTTACCTTGCACTCCTGTGCAGTCTGCCATGCTGGCGTCGTTTCTTGAGTCACAAGGCGACAATTAC
TTGAACATGGTCACGTACGAAATACAAACCGGCTTTAGTGTGGACGACTTGCTCCTCGCATGGAAAGAATTGGGT
CGTCGACATCAGATGCTTCGGACAGGATTCGTGGCCATTGACCACACGTATAGCGCGTTTGCCATGATTCGGCAG
TCAGCAACTGCTCTTGAGGGCGCGATTGATGTTTTCCGGGGCATCGAGTCTGAAGCCTTTGATTTGGACTCTTGG
AAAGAAGCACACCGCATTGAATTTGTTCAGAATTTGTCCACTCCGCCTTGGAAGGTTGTCCTGATTGACAAGGCA
AAGGGCGTATCAATGTCGTTGTTGTGTCATCACGCACTATATGATGCTCATTCTCTGCAAGGCCTTTTGGACGGC
TTCTGCGGTATCCTGCACGGAAAAAGCCCGTCTTATCCAGATATTGAGCCTGCACTGACTGAAATACTCTCTTGG
AACCTGCTCAATCAAGGCGCCGCTGAGACGTGGTGGAAGACAATGTCGGATAATACTGTGGTGAACAAGTTTCCT
CTAATGACCCCGCTGCGCGAGACGCGAAAACAGCCTCAAACCTTGCACAGCACATTGGACATGAGATTCAGTTTG
TTGCTAGCGTCATTGCAAGGCATTGGTGTTTCCGTTCAGGCCGCAGTTCAGGCCGCCTGGGCTCGCGTACTGGCC
TCGTATGTTGGCGAGAGCTCTGTTGTTTTTGGGGTTACCATGTCTGGCCGTACCAGTGAGGAGACGCAAAACACA
CCAATGCCGTGCATAACAACTGTTCCTGTCATAGCCGTTGTTGACGAGTCGAATGAGGAGGCGATGAGACTAATG
ATGGCATACAATACTGAGTTGTATAAGCATCAGTTTGTGCCCCTGAATAAGATTCAAAAATGGCTGGGCCATACT
GGGAGCCCTCTTTTCGATACGCTGCTCGTCTACCAAAGGGGAGATGACCTCGAGACGTCTGTCCGGCGACCGTTT
AAAGTGGTGGGGGAAGAGGCAAGGGTAGACTATGCCGTGTCGTTGGAAATTGAACCAGGAGGAGAAGACGGGATT
CATCTGTGCCTGTCCTTTTCCACAGACATATTACCTATGGAGCAAGCAAGCATTCTGGTGGCGCAGTTTGATGCT
ACACTCTGTTTTCTTGCCTCGCAACCGGCTGCAAGTCAGCAAGACTTGTACACGCTGAGGCCAGATCTCTTTTCC
GTCGTACCTGCGGCAATGCCTCAAATCAAGGCGCCTGTTGACTTGCTGCACCAGTTTGTCGAGATGCAAGCAGAA
CGCCAACCTGAAGAAGCGGCTCTTGAGTTTGTGAGCGGCTTCGAAAAGGGAATTCCCGTCAAGCAAGTCTGGAGC
TATCGGGAACTAGACATGTTTGGAGGCCGAGTGGCGAAGCTGTTGCAGCGTGATACCAGGCCCGGAGACATTGTG
GCAATTCAGTTTGACAAGCAGCCCGAAGCCTATTTTGCCATTCTCGGGATCCTCAAGGCTGGCTGCGCCTTTGTT
GCGCTCGATCCTAGTGCTCCACTTGCGCGCAGACAGTTCATCTTGCAGGACTCTGGGGCGAGTTGTCTTTTGCTA
GATGGCTCTACACACCTTGACTTTGAAACGACGACTATTATTGTTCGCATAGACTTGAAATCTTTGCGAAATGCT
CCGGATGAGCAGTTTAATCTGAAACTCGTGAAGCCGAGACCTGAAAGCACATGCTACTGCCTATATACATCTGGA
ACAACTGGAACCCCAAAGGGATGTGAAATATCTCACGAAAACGCAGTGCAGGCAATGATGGCATTTCAGGAACTT
TTTAGAGGCCATTGGCAAAAGGACTCGCGGTGGCTACAGTTTGCAGCTCTTCATTTTGACGTTTCAGTCTTGGAG
CAGTACTGGAGCTGGTCAGTGGGCATCACTGTCGTTTCAGCACCACGCCAAGTGATACTGGATAATCTTACTGGA
TCCATCAACAAGCTTGGCATCACTCACATTGACTTGACGCCGAGCTTGGCAAGACTGACACATCCGGATGAAGTG
CCGAGCTTGTGTCGAGGCGTATTCATCACGGGTGGAGAGCAGCTCAAGCAAGAGATTCTTGACAGCTGGGGATCC
AAGGCAGTCATTTACAATGCATATGGCCCCACGGAAGCTACAATTGGAGTGACCATGTACCCCCGCGTGCCTGTC
AATGGGCGGCCGAGCAATATTGGCAAGCAGTTTCTCAATGTTGGCTCATATGTAATGGTTCCCGGCACCGAGACT
CCAGTTCTTCGAGGTGCAGTTGGCGAGCTTTGCGTGTCGGGGAAGTTGGTGGGCAAGGGATATTTAAACCGGCCA
GAGCTGACGGCAGAAAGATTTCCAATGCTTGCAAATTTTAAGGAGAGAATCTACCGCACTGGCGATTTGGTGCGC
CTTCTTCATGACGGGTGCTTTGACTTTCTCGGACGCGCAGATGATCAAGTCAAGCTTCGAGGACAGCGATTGGAG
ATTGGGGAGATTGATCATGCGATTCGTGTGGGAGCAGCTAGTGTCAAGGACGTGGCGACGATTGTTGTGCGACAC
AAGTCTAATGACAAGGAAATGCTGGTGGCATTCTTGGTTGGAAATACGAGCGGCTCTGACGAGGTTGGAATTCTT
GCAGACACGGATGGGCTGGGGCAAGAGGCCAGAGCGGCGTGCCTTGAACGGCTGCCGGGATACATGGTGCCAACA
TATTTCCTCCGTCTGTCCCGCATGCCTCTTTCAGCGAACAACAAGGCAGAGCTCAAGATGCTGCGAAGCATGTTT
CAAGCTCTCTCGCATGAGGAGTTGCTAAAAATTTCGATTAATGGCAGCGCGGCATATAGTGGCAACCTGGACGAG
CGTCATGTGGAAAAGGTTGGCCGTGTGCTTTCAAAGTTTTCGAGCGTTGCACAAGATGCGATTTTGCCGTCGAGC
AGTATATTTGACCTTGGAGTCGACTCTATTAGCGCGTTGAGACTTGCCATGCTGCTCAAGGCTGAAGGATTCGAG
ACTGCATCGTCGGCTTTGATACTCAAATCGCCCATTGTTGGCGACCTTGTCAGAGCAATGACTGCCGCACCAGTC
GGCGCATCGACGTCTGGCTTGATTCGGGAAGCCAGACAGGCGATACAGGCCTGCCATTGCAGACATCAGCCTCTT
GTCTGCCGCGAGCTGGGCATTGGACCGGCAGACATTGAATACATTGCACCATGTTCGCCGTTACAGCAGGGCATA
TTGTCGAGATGCATGACTGAAGAAGCTTCCGAAGCATACTTTAATACTTTGGAGCTACGACTTGATGAGAATGCC
TTGGCAAAACGAGCTCGGCTAGCATGGAGTCGACTGGTTGACAAGCATGCCATTTTGAGGTCTTGTTTTGTCAAT
ACTGGCGAGGGGTATATTCAAGTGGCGCTGAACAAGGCTCCAACTGGCTGGAAGATTTTGACTGCAGAGACTGAG
GAGGAAGCTGATGCCATTATGAAGAAGACGCGACGAGACTGGATGGCAAGGAACCGGCATGACGTCTTGGAGCCG
CTGGAGTTTGTGCACGTTTGTGGACCAAGCCGACAAAGATTGTTTTTGCACATGTTTCATGCGGTATATGACGGA
TGGAGCATTGAAAACATGAGGCAGTATGCCACTGCTCTGTACCACGACCGGCAGCCAAGCCAAGGACCCATGTTT
ATCGAAGCACTGACTCACGGGCCTTTATGGAGACTTGAAGGCTGTAGAGGATTCTGGATGGAGCATTTACGGGGC
TGGGAGCCGCGCCCAATGCCTCTTGTCGAGTCGTCCTCTCCGCAAGTCGTCGTGTCTGCATCGCGAAGCGTTCCC
ATTGGCGCGTTTGAGCATCTGCGCTGTGAGCAAAATGTCACTATGCAGTCTGTCGTACTGGCAGCGTGGACCAGG
GTCTTGCAGCGATATATGGCAGGGAAGACGACGATTGGGGTCATCATTGCAGGCCGGTCAATGGAATTGGCTAGA
GTGCAAGATTGCATTGGTCCCTTGTTCAGCACGGTGCCCTTTTTCAGTCCTAGGCTGCGGCAAATAAGCTGGGCT
TCACTGATACGCCGCGTTCACGAATTCAGTACATGTATTCTCGCATTTCAACACGTGCCGCTCAAGAGCATACAA
AAGTGGTGCTCTGGGGGTCGTTCACTGTTTGACACGTTGTTTGTGTTTCAACGAGAGCAGCCTAGTGCAGAGGAA
GACGAGCCGTGGACAATGGTGGACGGGCCGAGCTATCCAGACTATCCGCTTGCTTTTGAAGCGGTGCAGTGTGGC
GATGGGCATGTCAAGCTTTCGATTGTTGCTCAAGGCCGCTATGCCACACAGAGTATGCTTGAGGAGATGCTTGCC
GAGTGTGAATTGGGTGTGGAAAAGGCACGGGGGGAAGACGCGGTGAATGCTGACTTGGATGGGGTCGTTGAAGAA
GAGGCAACAGCAGGAGCGGCGATGAGTGACGGACAAGAGTCGGTCATGGATTCCATCGACTTTTTCTGGACGGAT
GAAGCGCTTTTAATCAGGGACGAGATTGCCAGTCTGGCCAGCATGGACAAGGAGAGAATAAGTGCGTCGACGTCG
ATGCTGCAACTGGGTCTTGACAGCATTGATGTCATGAAGCTGGCTGCCAGGTTGAAGAAGAAGGGCCTTGAGCTG
TCAGCATCGCAGATTATGCGCCAGCAGACCATTTTGCGCATGACGCAAGAGACACGGCTGGCCGGCCATGGAGAG
AATGAAGATGCAAGTCTTGCACATGAGATGTTGGCAAAGATGAGGCCGATTCTATGGGCTCAGGCGAGGCAAGCT
GGAGTTGATGTGGAAAAGGTGGAATCAGTTTTGCCGTCGACGGCCCTCCAAGAAGCCATGGTGGCAGGCATGTTG
CAATCAGACTTTGCGTGGTACTTTAACCACGATGTGCTCGAGGTGTCTGAAGCAGTCGATTTGCAGAGACTGCGA
GCCGCGTGGGAAAAGGTGGTTGAGCAATCTCCCATTTTGCGGACGGGCTTTGTCGCTGTGGAAGAGACTGCTCTA
GACACTGCATACTGTCAAGTGGTGTTTGGACACGAGGCCTTGAATATCGAGACTGTGCATCTAGACGACATGGGA
GAGATGAAGCAGCTTATTGCGGATGCGACTGAGCGAGCCAGACGAGGAGCTGGTGTTGAGAAGCTGTTTCAGCTA
CAGTTTGCAACACTTGGCAGTCAAAGATTTATCGTGCTTTCACTTGCTCATGCGCTGTATGATGGGTGGTCGATG
GGCCTCGTGTACAAGGATCTCGAGGCGGCGTACCGAGGCGAGCTGGAAGCAAGGCCGGCAGCGGGAGACTTTATT
GCGCAGACGCTTACATGCATGACGAGTGAGGCGCAAGGATTCTGGAGCAACTACCTGGCTGGTGCATCTGCAACC
ATGATTTCTGGATCAAGTCAGTCGGTGGCGGCAGACACTGTTGTGCTCAGACAAGAGTCGGCCAAAGTGCCGCTC
TCCCGCGTTCGGGCACTTTGCACAAGACTGTCAGTCAGTCTCCAGGCTCTCTGTGCCTCGTGCTGGGCCGTGGTG
GCGGCTGAGCAGACGCGGTCTCTGGATGTCGTCTTTGGGCTGGTGCTTGCGGGCAGAGATGGGCCGGGTGCGGAG
AGTCTAATGTTTCCAACCATGAATACGGTTGCCTTGCGCTGCGTCTTGCACGGCACCGTGGCGGATCTCGTGTGC
TACGTGCAAGACGGCTTGACTGATGTGCGCCGGTGGCAAAGCTTTTCTCTACGCAAGGCATTGACGGGTTCGAGG
CCGTTTAACTCGCTCTTTTTGATGCAAAAGACACCAGACAATAAATCGAGTGAGGCGCTGCTGCGTTCGGTTGAT
GGAGCATCTGTTGTTGATTATCCGGTATGTGTCGAGGCTGAGGCTGATGCCGAGTCGGCATGTTTGGTGTGGCGG
GTTGCCTGTCATGAGAAGCTCTTGTTGGCGGACGAGGTGGATGCGCTGGTGGACAAGCTTGACGTCGTCTTGGAG
TATATGCTTGAGCAACCAGCGGGCAATGTCTTGGTGTTTGAGCGTGGGGGCGTGTCGATTTGCAGGCTGCCTGCT
GTGGAGATTGGTGATGAGGAGGAGAGAGTAGTTGATGGCGGCGAGGCGCAAGATGGAGAGGAGGAGCATGGCGAG
TGGGCAAGGGCGTTGAGGCAAGTGGTGGCGGATGTGGCGCATGTTGCCGTGGAAGCGGTCGACATGTCGCTGACG
CTGTACCACTTTGGCCTCGACTCAATTAGCGCCATCAAGGTGTCGATGCAGCTGCGCAAAAGGGGGCTTTTTATC
ACGCCGCGAGAACTAGCTGGCGCACCGAGTCTGAAGCAGCTTGTCCGTCTTTTCCGTTGCAGCCAAGAGGGCAGC
GTGGCAACGCAGTGGACACCCCCTGCCGAGGTGTCAATCCAGAGGCTTATAAAGGAGAGCGGGCTAAAGCAAGAA
GCAGTCGAGGCAGTGCTGCCCGCCACAGCAATGCAGATATACATGCTGTCAACGTGGCAAAACTCGCGCGGGGCA
CTGTTTTACCCAGCCTTGACGCTGCGGGGAAGGGCAGACGAGGTGCGGCGGGCGTGGGAGCAAGTTGTTTGCGAG
ACGCCGGTGCTGCGGACGCGATTGTGGTGA
Gene >OphauB2|5376
ATGGATGCTCATCATCATCTTTCCAGTCTCAACCAAAATCCTGCAAAGCTTGCCGGTCCGGGCCTCTTGCACCAT
CTGGTGGGCCCGCCGAGCCAGCGTTTGGCCCTGGAGCACTCGTCGCACAACAAGACGACGTTGTACACCTATCGG
GACCTGGACGATGCCTCCGAGGCTGTCGCACAGCGCATCACTGCCGCTTGCTGCCACGCCACGCCCTCTCTTTCC
GACTTTGTAGTTCCCGTCCTTGTTTCGCAGTCTGCTCTGCTCTATATTTCCTTGCTTGGCGTGCTCAAGGCTGGA
GGCGCGTTTTGCCCCGTTGCAATCGACGCTCCACTGGAGAGAATCAGATTTATCCTTGACGATGTGTCTGCTCAA
GTCGTCGTCGTTTCCAAGGACCTGGCGTCGAGGATACCGCAGGATACTCGTCTTCAAGTAATTTGCGTCGACGAC
TTGCATTTTCGTCTTTCCAATGGCCCTGCAATCCATCGCCAGCCAGTCCCTCAAGACTTGGCCTATGTCATGTAC
ACGTCTGGCTCTACTGGAACACCAAAGGGAGTGGCCATTACTCATTTGGCCGTGACGCAAGCTCTTCTTGCTCAC
AATCGTCATGTACCTCAGTTCAACAGATTTCTTCAGTTTGCTGCGCCAACATTTGATGTGTCCGTCTTTGAAATA
TTCTTTCCCCTCTTTCGCGGCAGCACCCTTGTCTCGGTGCGCCGGCAAGAGATGCTGGATGATTTACCAGCCGTA
ATTCGCAAAATGGACGTGGACGCTTGTGAATTGACGCCTACCGTGGCTAGCAGCTTGCTGAGGAGCAGAGACGAT
GCTCCTAGTCTAAAGCTTCTCTTGACCATTGGGGAAATGCTCAAAACACCAGTTGTTCGAGAATTTGGCGCAAGC
TTGCACCGACAAGGCATCTTGTGGGCCATGTATGGTCCAACAGAGGCGACAATTCACTGGTAAGACAGTTACGGG
CAAGAGCACCAAGGTGTCGCGTCTCTGACTTTATACGCAGCACTCTGCAGACGGCCATGTCGTCTGAATCGTCGA
CGACGAATATTGGAGTCCCGCTTGACTCGGTTTCCTGCTTCATTATAGAGCCTCTTGAAGATTCAACAGCGAAGC
CATGCGAGTTTAAAATCCTGCCAATTGGCGAGGCTGGCGAATTAGCAATTGGGGGACACCAACTTGCCAGGGGCT
ACCTAAACCGACCCGAGCAAACAGCCGCTGCCTTTATTCAATCGCCGTACGGCCGCCTGTACCGAACTGGTGACA
GGGCTCGTTTGACTGCTTCTGGAACACTTGAGTGTTTGGGCCGGCTGGTTAGTGGGCAAGTCAAACTGCGTGGCC
AACGAATCGAGCTTGGCGAAATTGAGCACGCTGTTCTAGAGACGCCAGGCTGTCACGATGCAGTAGCAGCTGTCG
TGGATTCCAACCTTGTGGCGTTTTGTGCCGTGGATCATCACGTCACCCAAGATGCCCTCATTTCGACTTGTGCAG
AATGGCTTCCGCGCTTCATGGTTCCAGCAGAGTTTGTATTAATGCAATATTTGCCGCGGCTTTCAAGCGGCAAAG
TTGACACCAAGAAGCTCTTGTCCGACTTTGGCGAGCAACGGGCGACTTCACTAGGCTTTGAGAGTGCTGACACAC
GCCTTGATTCTCATCAGCATCTTGTCCTCGAGATAGTGTCCACTATACTGGGCATTAGAGTCAACGAAAAGATGA
CCATGGCTGCTGCTGGCGTAGACTCTCTAGCGGCAATCAAGCTGGCTTCTGCTCTAAGACGACAAGGGTTTGACG
CCATAGCCACGGAGCTTTTGCGACTAAAGACGCTGTCTGATCTTTGTTGCACTCTTCTAAAGAGACCGTTTGTGG
AATCCATTACTCGGGAGCTCTCAGGGGAACAAGGGCTGCGCCTTACTATTCCACCGGTAGGGGACAGACAGCCCG
CGGCAACCGACTGTCTGCCATGCACCTTTCTTCAGTCAGCAATGCTGGCCGAGACGGTACAAGATGTAGAAATGT
ACTGCAACGAAATCGAATTGCAGGTCAACTCGGACATTTCGCTGGACGCTATTTGCGCTGCTGTCCTTCGAGTAG
CTGAGGAAAACGAGGTTTTGCGCATGGGATTCTCCCGATGGCAAGGAAACTGGGTCGCCGTTGTGTTCAAATCTC
TTGATCCGCAAGCCGTGCGCGTTGTGCCTCGCCTTCGACATGGATTTACTCTGCCAGACCTGGACGACTTTTTGA
TGCCCTTGAGAGTCCAGATTGAGTCGGATGTGAATGAATCTGGGCGACGCGTTTTAATCCAGGCCCATCATGCCG
TGTTTGATGGCTGGTCAGTAGACATGATGTTGTCAGACATGTCGAGTATATTGACAGGATCCATTCCCCAACCCC
GACCACAATTTCGAAAGGTCTTGGAATACCGGCATCATCATTTGGGAGGCGACGAAGAGAAAAAGTTTTGGAGCG
AGTATCTCTTGGGATGGCACAAGGTCCCCTTTCCAAAGCTGGTCGGCCGCCACCTGACAAACAAGATGGAGACGA
CAAGGGAAACATTACAACTATCGCCGCAGCTCGTACGGGAGTCTGTTTCAAAATTAGGCCTCAGTGCTCAAGTTC
TTTTTCAGGCTTCTCTAGCTTTCTGCTGGAGTGCTGTTCTCGGAGCAAACGATGTTGTGATTGGATCCGTCACTG
CTGGCAGAACCTTGCCGATTGAAGGCATTGACAGAATCATGGGTCCATGCATTGCATCTCTTCCTCTTCGAGTTG
GTATGAGAAACGCGGCGTCTAATCTGGATGTCCTGCAAGACATTCACGGGAGCAACCGAGCCGTCATGGATCACG
CATCTCTGCCGCTCTTGGAAATCAAGAAGCTGGCAGGTTTGCAAACGACAGAGAGTCTATACGACGTGCTGTTTG
TCTACCAAGAGTCTTTGCTTACTTTTGAGGAAAAGAAGAAGCAATTGGTTGTGCAGCAAGACCATCTCGATCGCC
TAGAGACTAGACTCCTCCTAGAAGTCGAACCCCGAGATGGAGAGTATGTGCTGCAAGCAACATTTCACTGTGCAC
ACTTTTCATTGGAATTTGTCAAGTGTTTTTTGCAGCAGTTTAGCCATAGGCTTCAACAGCTTCTTCAGCAAATTG
ACCCCTTGTTTTCTGGGCAGGGCATCTTGTCAAAACCTCAGGTGTCTATTTACAACCAAGATGTAAAAGCCTTTA
CTGGGGTTCCCGACTTGGCCGCCCAGTTCGAGATGACGGCAGCAAAGATACCAAATGACACGGCTCTTTTATTCA
ACAAGTCTCCAGATTTATCGGCGGCTACTTTTACCCTGTTGACATATCAGCAGCTGAACAATGCTGCTAATCAGG
TGGCACATTATTTACGGAGCCGTCTTGTCGAGCCGAACCAGGTTCTAGCCATTGTCATGGACAAATCACCGACCT
TTTACATTTCCATATTGGGCATCGCAAAGGCAGGATGTGCCTACATGCCACTTTTACCGACGACTCCAATTTTGC
GGATTCGCGACGTGCTGAGACATGCAAACATCGCATACTGTCTAGTAGACAACGCCTCGCAATCCGCTCTCGATC
TCGATCAAGATGTCAATACTCTAAACATCGAAAGCGCACCTATAGGCTCTTTTCCTGACCACAACTTGGGCATCG
CTGCAGATGCCTCTCGTCTAGCCTATGTGATTTATACTTCTGGGACCACTGGAGTTCCCAAAGGCGTTGCCGTAA
CTCAAGGCAACATTGTCAGCAACATTGCATATTTGCGATCGATATACCCCTTTTCAGCAAGCAAGCAGTCTCGAT
TCCTGCAAGCCTGTTCTCAAGCTTTTGATGTTTCAGTTTTTGAGATATTTTATGCATGGATTGCGGGCATGTGTC
TCTGTTCAGCGACAAATGACGTCCTCTTTTCTGACTTGGAAGAGTCTATTCGACAATTCGAAATCACACATTTAA
GCCTGACACCAACTGTTGCGTCAATTATTGATCCTACTCAAACTCCGGGGGTTGAGTTTCTCGTCACTGCAGGCG
AGCCAATGACTTGTTCAGTTCTTGAGCGCTGGGGAGATCGGTTGTGGCAGGGATACGGGCCCTCTGAGACGACAA
ACATATGCAGCGTCAAGCACATGACTAGAATTGAACATATTGAGCATCTCGGCTGGGTATTTCCCAATACATCGG
TGGCTGTTGTGAAGTCGGGAACTCTCGAGATTCTTCCGATGGGATGTGTCGGTGAATTCTGCTTTGGCGGCGACC
AGGTGGCTCAAGGATACCTCAACGACACTAGTCGCACAACTGAAAAGTTTGTTTTGCACCCTCGGCTTGGGAGGG
CATATTTATCAGGAGATGTGGGAAGAATGCTTCCCGACGGCTCCTTGGTAATTCTCGGCCGGCTAGATGACCAGT
TCAAGTTGCGGGGTCAGCGGATTGAGGCTGGCGAGATTAGCGGAATTGTGACGGGGACGGGACTTGCCTCATCTG
CCGTTACTATGATTGTTCGGCGGAGAGAGGGAGCGCCTGATCAGCTTGCAGTCTTTTACACGCCTCGCCAAACAC
ACGCCGAGTTTGACCGTTTAAAAGTGGATCGAGAAACTCAGGGCCTGCTGTTTAGCAGTTTACAGTCTCGTTTGC
CTTTATTCATGGTGCCTTCTTATCTGGTTCCAGTGTCTATTATTCCTCGCACATCCAGCGGCAAGATTGACCGAC
GTCATCTCCAGACTAGCTTTGAGGAATTATTCCAGGAGGAACTAGAATGTTTTTCTTATTCCAGGCAGAGACAAG
ATGACCAAGGAGACTGGTCAGATGCCGAATTGGCTCTCGTCGAGGTCATTGCAACGTGGGCCAAGGTGGAAAGAG
GGGAAGTCGGAAGGTGGACTCCGTTTGCAGCCCTTGGGATTGACTCCATTTCAGCCATTGACGTCTCACGAGCCG
TGAGCTCCTGTTTAAAAACCCGTGTCCCTATATCAGCCATTATGCAGAACCCGTCTATTGCGCAACTGGCAAGAC
ATCTTGAAGCAAAGGTTGGACAAGAGGCTCATGTCAGTTCTGAAAAAGTCGACGTTTTCGACCTTGGAATTTCGG
AAGACAGCCTAAGAGCTTGTGGCCAGAGTGTCATGGCTGTGGAGGACATTTTGCCATGCACGCCACTACAGGAGG
CCATGTTGGCCCAAAGATCAAACAGTTACTGTAACAAGACACTGCTGCGCCTACGAATCACGGCTGATGAACTAA
TGGCATTTTGGGACACAATGACGCAAAGGCATGGTATCCTCAGGACCTTTTTCTTGACGACTAGAAACACTGCAC
GGCCAATGGCTCAGGTTATTCTTAAAGAGTACAAGACACGGTGGAAAGAATTCGACCTCTATGAACCTTCATTTG
CAGACGTGACGCACGAGCATGCCGAATGTTTACCTGAACTTTTGGACTCTGGAAAGCCTCCACTAACGTGTGCCA
TTATACGGTATAGAGGAATTTCCTTCTTCTCTCTCATCTGCCACCACGCTCTATATGACGGTGTCGCAATGGGAA
CTCTCTGGAGAGAGATTGAAACTCTGGCCAATGGCGGTGCTCTGCCGCAACCTGTGCCTTTTAGACACTTTATCG
AAAAGGCGCTAGACCTTCCACAAGACACAAGGAGCTTTTGGGCCAATCATTTTCGCGATTTCGAACCTTTGAACC
TGTTTACGCAGCTGGCAGGGGCAAAGATTAGCCAATCCAGTCATACCATGTCTCTGGGAATGCCACTAAGTGACG
TACAAGAGAGGCTGCGATCTATAGGGTCAGCTTTGCTTCCCTTGTGTCAAGCAGCATGGGCACAAGTCCTTTTTT
TCGTGACTGAATCATTGGACGTGGCTTTTGGGAATGTAGTCAGCGGCCGGACTCTGGACTTGGATGGACTGGACC
GCCTGGTTGCGCCTTGCTTCAACACTATACCAATGCGCAAAAATTTGATGAGCACGGGCCAGAATATTCAACTCA
TTCGAAGTTTTCAGTCCTTGAATGTGCAAATGATGCGCTATCAGTTTACTTCGGTACGGGATGTCCAAAAGTTTG
CCAACTGTAAGAGAAGAGGGCTTTTTGAAACGGTACTCTTGCTGCAGCAACCGTTGCAAGAAATGGATGAGAGTG
TTTGGACGCTAGAGGAAGATTCGGGGGATATGGATGTTTGCGTGGTTTGCGAAGTGGTGCCCTGTCCGAACCTCA
ACTCGTTGATTGTCAATATGCATCACGACATTGCTACAGTCTCGGGAGAGGCTGCGTCGACAATGGCAGACATTT
TCAACCATGTGTTTCAACGTCTAATACAGGCTCCCCTGGCGAATATAGAGGATAAGAGTGACCTCTCTCAGCAGT
TGAGAGCAAGTCTTGATAATCTCATACCGAGCAAGGAGAAACCGATGCACGAGGATGTTGGAGAATTAGACTACG
AGGTTTGGACTGACCTCGAACGAAGGATTCAAACTGTCCTTGTGAGTTTGTCAGGGGCATCGGCAGACAAGGTTT
CACGGCGCACAACCATTTTTAGACTTGGTTTGGACAGTATCAATGCCGTGCAGGTTGCAGCCATTTTGAGAGGTC
AGGGCTTCAAGTTGTCCGCTTCGGATGTCATTGAATGTCCGGATTGCGAATCTTTGGCCAAGCGGATCTCTCAGC
TCTTGGAAGATGGCCAGAGACTTGAAATGGTGAATCTCAAGGACTTTGGGTTGCAGGTCAAGGAACAAATTGGCG
ACAAGATTTTACAGGCTGTTCGAATCGAAGCCATTTTACCTTGCACTCCTGTGCAGTCTGCCATGCTGGCGTCGT
TTCTTGAGTCACAAGGCGACAATTACTTGAACATGGTCACGTACGAAATACAAACCGGCTTTAGTGTGGACGACT
TGCTCCTCGCATGGAAAGAATTGGGTCGTCGACATCAGATGCTTCGGACAGGATTCGTGGCCATTGACCACACGT
ATAGCGCGTTTGCCATGATTCGGCAGTCAGCAACTGCTCTTGAGGGCGCGATTGATGTTTTCCGGGGCATCGAGT
CTGAAGCCTTTGATTTGGACTCTTGGAAAGAAGCACACCGCATTGAATTTGTTCAGAATTTGTCCACTCCGCCTT
GGAAGGTTGTCCTGATTGACAAGGCAAAGGGCGTATCAATGTCGTTGTTGTGTCATCACGCACTATATGATGCTC
ATTCTCTGCAAGGCCTTTTGGACGGCTTCTGCGGTATCCTGCACGGAAAAAGCCCGTCTTATCCAGATATTGAGC
CTGCACTGACTGAAATACTCTCTTGGAACCTGCTCAATCAAGGCGCCGCTGAGACGTGGTGGAAGACAATGTCGG
ATAATACTGTGGTGAACAAGTTTCCTCTAATGACCCCGCTGCGCGAGACGCGAAAACAGCCTCAAACCTTGCACA
GCACATTGGACATGAGATTCAGTTTGTTGCTAGCGTCATTGCAAGGCATTGGTGTTTCCGTTCAGGCCGCAGTTC
AGGCCGCCTGGGCTCGCGTACTGGCCTCGTATGTTGGCGAGAGCTCTGTTGTTTTTGGGGTTACCATGTCTGGCC
GTACCAGTGAGGAGACGCAAAACACACCAATGCCGTGCATAACAACTGTTCCTGTCATAGCCGTTGTTGACGAGT
CGAATGAGGAGGCGATGAGACTAATGATGGCATACAATACTGAGTTGTATAAGCATCAGTTTGTGCCCCTGAATA
AGATTCAAAAATGGCTGGGCCATACTGGGAGCCCTCTTTTCGATACGCTGCTCGTCTACCAAAGGGGAGATGACC
TCGAGACGTCTGTCCGGCGACCGTTTAAAGTGGTGGGGGAAGAGGCAAGGGTAGACTATGCCGTGTCGTTGGAAA
TTGAACCAGGAGGAGAAGACGGGATTCATCTGTGCCTGTCCTTTTCCACAGACATATTACCTATGGAGCAAGCAA
GCATTCTGGTGGCGCAGTTTGATGCTACACTCTGTTTTCTTGCCTCGCAACCGGCTGCAAGTCAGCAAGACTTGT
ACACGCTGAGGCCAGATCTCTTTTCCGTCGTACCTGCGGCAATGCCTCAAATCAAGGCGCCTGTTGACTTGCTGC
ACCAGTTTGTCGAGATGCAAGCAGAACGCCAACCTGAAGAAGCGGCTCTTGAGTTTGTGAGCGGCTTCGAAAAGG
GAATTCCCGTCAAGCAAGTCTGGAGCTATCGGGAACTAGACATGTTTGGAGGCCGAGTGGCGAAGCTGTTGCAGC
GTGATACCAGGCCCGGAGACATTGTGGCAATTCAGTTTGACAAGCAGCCCGAAGCCTATTTTGCCATTCTCGGGA
TCCTCAAGGCTGGCTGCGCCTTTGTTGCGCTCGATCCTAGTGCTCCACTTGCGCGCAGACAGTTCATCTTGCAGG
ACTCTGGGGCGAGTTGTCTTTTGCTAGATGGCTCTACACACCTTGACTTTGAAACGACGACTATTATTGTTCGCA
TAGACTTGAAATCTTTGCGAAATGCTCCGGATGAGCAGTTTAATCTGAAACTCGTGAAGCCGAGACCTGAAAGCA
CATGCTACTGCCTATATACATCTGGAACAACTGGAACCCCAAAGGGATGTGAAATATCTCACGAAAACGCAGTGC
AGGCAATGATGGCATTTCAGGAACTTTTTAGAGGCCATTGGCAAAAGGACTCGCGGTGGCTACAGTTTGCAGCTC
TTCATTTTGACGTTTCAGTCTTGGAGCAGTACTGGAGCTGGTCAGTGGGCATCACTGTCGTTTCAGCACCACGCC
AAGTGATACTGGATAATCTTACTGGATCCATCAACAAGCTTGGCATCACTCACATTGACTTGACGCCGAGCTTGG
CAAGACTGACACATCCGGATGAAGTGCCGAGCTTGTGTCGAGGCGTATTCATCACGGGTGGAGAGCAGCTCAAGC
AAGAGATTCTTGACAGCTGGGGATCCAAGGCAGTCATTTACAATGCATATGGCCCCACGGAAGCTACAATTGGAG
TGACCATGTACCCCCGCGTGCCTGTCAATGGGCGGCCGAGCAATATTGGCAAGCAGTTTCTCAATGTTGGCTCAT
ATGTAATGGTTCCCGGCACCGAGACTCCAGTTCTTCGAGGTGCAGTTGGCGAGCTTTGCGTGTCGGGGAAGTTGG
TGGGCAAGGGATATTTAAACCGGCCAGAGCTGACGGCAGAAAGATTTCCAATGCTTGCAAATTTTAAGGAGAGAA
TCTACCGCACTGGCGATTTGGTGCGCCTTCTTCATGACGGGTGCTTTGACTTTCTCGGACGCGCAGATGATCAAG
TCAAGCTTCGAGGACAGCGATTGGAGATTGGGGAGATTGATCATGCGATTCGTGTGGGAGCAGCTAGTGTCAAGG
ACGTGGCGACGATTGTTGTGCGACACAAGTCTAATGACAAGGAAATGCTGGTGGCATTCTTGGTTGGAAATACGA
GCGGCTCTGACGAGGTTGGAATTCTTGCAGACACGGATGGGCTGGGGCAAGAGGCCAGAGCGGCGTGCCTTGAAC
GGCTGCCGGGATACATGGTGCCAACATATTTCCTCCGTCTGTCCCGCATGCCTCTTTCAGCGAACAACAAGGCAG
AGCTCAAGATGCTGCGAAGCATGTTTCAAGCTCTCTCGCATGAGGAGTTGCTAAAAATTTCGATTAATGGCAGCG
CGGCATATAGTGGCAACCTGGACGAGCGTCATGTGGAAAAGGTTGGCCGTGTGCTTTCAAAGTTTTCGAGCGTTG
CACAAGATGCGATTTTGCCGTCGAGCAGTATATTTGACCTTGGAGTCGACTCTATTAGCGCGTTGAGACTTGCCA
TGCTGCTCAAGGCTGAAGGATTCGAGACTGCATCGTCGGCTTTGATACTCAAATCGCCCATTGTTGGCGACCTTG
TCAGAGCAATGACTGCCGCACCAGTCGGCGCATCGACGTCTGGCTTGATTCGGGAAGCCAGACAGGCGATACAGG
CCTGCCATTGCAGACATCAGCCTCTTGTCTGCCGCGAGCTGGGCATTGGACCGGCAGACATTGAATACATTGCAC
CATGTTCGCCGTTACAGCAGGGCATATTGTCGAGATGCATGACTGAAGAAGCTTCCGAAGCATACTTTAATACTT
TGGAGCTACGACTTGATGAGAATGCCTTGGCAAAACGAGCTCGGCTAGCATGGAGTCGACTGGTTGACAAGCATG
CCATTTTGAGGTCTTGTTTTGTCAATACTGGCGAGGGGTATATTCAAGTGGCGCTGAACAAGGCTCCAACTGGCT
GGAAGATTTTGACTGCAGAGACTGAGGAGGAAGCTGATGCCATTATGAAGAAGACGCGACGAGACTGGATGGCAA
GGAACCGGCATGACGTCTTGGAGCCGCTGGAGTTTGTGCACGTTTGTGGACCAAGCCGACAAAGATTGTTTTTGC
ACATGTTTCATGCGGTATATGACGGATGGAGCATTGAAAACATGAGGCAGTATGCCACTGCTCTGTACCACGACC
GGCAGCCAAGCCAAGGACCCATGTTTATCGAAGCACTGACTCACGGGCCTTTATGGAGACTTGAAGGCTGTAGAG
GATTCTGGATGGAGCATTTACGGGGCTGGGAGCCGCGCCCAATGCCTCTTGTCGAGTCGTCCTCTCCGCAAGTCG
TCGTGTCTGCATCGCGAAGCGTTCCCATTGGCGCGTTTGAGCATCTGCGCTGTGAGCAAAATGTCACTATGCAGT
CTGTCGTACTGGCAGCGTGGACCAGGGTCTTGCAGCGATATATGGCAGGGAAGACGACGATTGGGGTCATCATTG
CAGGCCGGTCAATGGAATTGGCTAGAGTGCAAGATTGCATTGGTCCCTTGTTCAGCACGGTGCCCTTTTTCAGTC
CTAGGCTGCGGCAAATAAGCTGGGCTTCACTGATACGCCGCGTTCACGAATTCAGTACATGTATTCTCGCATTTC
AACACGTGCCGCTCAAGAGCATACAAAAGTGGTGCTCTGGGGGTCGTTCACTGTTTGACACGTTGTTTGTGTTTC
AACGAGAGCAGCCTAGTGCAGAGGAAGACGAGCCGTGGACAATGGTGGACGGGCCGAGCTATCCAGACTATCCGC
TTGCTTTTGAAGCGGTGCAGTGTGGCGATGGGCATGTCAAGCTTTCGATTGTTGCTCAAGGCCGCTATGCCACAC
AGAGTATGCTTGAGGAGATGCTTGCCGAGTGTGAATTGGGTGTGGAAAAGGCACGGGGGGAAGACGCGGTGAATG
CTGACTTGGATGGGGTCGTTGAAGAAGAGGCAACAGCAGGAGCGGCGATGAGTGACGGACAAGAGTCGGTCATGG
ATTCCATCGACTTTTTCTGGACGGATGAAGCGCTTTTAATCAGGGACGAGATTGCCAGTCTGGCCAGCATGGACA
AGGAGAGAATAAGTGCGTCGACGTCGATGCTGCAACTGGGTCTTGACAGCATTGATGTCATGAAGCTGGCTGCCA
GGTTGAAGAAGAAGGGCCTTGAGCTGTCAGCATCGCAGATTATGCGCCAGCAGACCATTTTGCGCATGACGCAAG
AGACACGGCTGGCCGGCCATGGAGAGAATGAAGATGCAAGTCTTGCACATGAGATGTTGGCAAAGATGAGGCCGA
TTCTATGGGCTCAGGCGAGGCAAGCTGGAGTTGATGTGGAAAAGGTGGAATCAGTTTTGCCGTCGACGGCCCTCC
AAGAAGCCATGGTGGCAGGCATGTTGCAATCAGACTTTGCGTGGTACTTTAACCACGATGTGCTCGAGGTGTCTG
AAGCAGTCGATTTGCAGAGACTGCGAGCCGCGTGGGAAAAGGTGGTTGAGCAATCTCCCATTTTGCGGACGGGCT
TTGTCGCTGTGGAAGAGACTGCTCTAGACACTGCATACTGTCAAGTGGTGTTTGGACACGAGGCCTTGAATATCG
AGACTGTGCATCTAGACGACATGGGAGAGATGAAGCAGCTTATTGCGGATGCGACTGAGCGAGCCAGACGAGGAG
CTGGTGTTGAGAAGCTGTTTCAGCTACAGTTTGCAACACTTGGCAGTCAAAGATTTATCGTGCTTTCACTTGCTC
ATGCGCTGTATGATGGGTGGTCGATGGGCCTCGTGTACAAGGATCTCGAGGCGGCGTACCGAGGCGAGCTGGAAG
CAAGGCCGGCAGCGGGAGACTTTATTGCGCAGACGCTTACATGCATGACGAGTGAGGCGCAAGGATTCTGGAGCA
ACTACCTGGCTGGTGCATCTGCAACCATGATTTCTGGATCAAGTCAGTCGGTGGCGGCAGACACTGTTGTGCTCA
GACAAGAGTCGGCCAAAGTGCCGCTCTCCCGCGTTCGGGCACTTTGCACAAGACTGTCAGTCAGTCTCCAGGCTC
TCTGTGCCTCGTGCTGGGCCGTGGTGGCGGCTGAGCAGACGCGGTCTCTGGATGTCGTCTTTGGGCTGGTGCTTG
CGGGCAGAGATGGGCCGGGTGCGGAGAGTCTAATGTTTCCAACCATGAATACGGTTGCCTTGCGCTGCGTCTTGC
ACGGCACCGTGGCGGATCTCGTGTGCTACGTGCAAGACGGCTTGACTGATGTGCGCCGGTGGCAAAGCTTTTCTC
TACGCAAGGCATTGACGGGTTCGAGGCCGTTTAACTCGCTCTTTTTGATGCAAAAGACACCAGACAATAAATCGA
GTGAGGCGCTGCTGCGTTCGGTTGATGGAGCATCTGTTGTTGATTATCCGGTATGTGTCGAGGCTGAGGCTGATG
CCGAGTCGGCATGTTTGGTGTGGCGGGTTGCCTGTCATGAGAAGCTCTTGTTGGCGGACGAGGTGGATGCGCTGG
TGGACAAGCTTGACGTCGTCTTGGAGTATATGCTTGAGCAACCAGCGGGCAATGTCTTGGTGTTTGAGCGTGGGG
GCGTGTCGATTTGCAGGCTGCCTGCTGTGGAGATTGGTGATGAGGAGGAGAGAGTAGTTGATGGCGGCGAGGCGC
AAGATGGAGAGGAGGAGCATGGCGAGTGGGCAAGGGCGTTGAGGCAAGTGGTGGCGGATGTGGCGCATGTTGCCG
TGGAAGCGGTCGACATGTCGCTGACGCTGTACCACTTTGGCCTCGACTCAATTAGCGCCATCAAGGTGTCGATGC
AGCTGCGCAAAAGGGGGCTTTTTATCACGCCGCGAGAACTAGCTGGCGCACCGAGTCTGAAGCAGCTTGTCCGTC
TTTTCCGTTGCAGCCAAGAGGGCAGCGTGGCAACGCAGTGGACACCCCCTGCCGAGGTGTCAATCCAGAGGCTTA
TAAAGGAGAGCGGGCTAAAGCAAGAAGCAGTCGAGGCAGTGCTGCCCGCCACAGCAATGCAGATATACATGCTGT
CAACGTGGCAAAACTCGCGCGGGGCACTGTTTTACCCAGCCTTGACGCTGCGGGGAAGGGCAGACGAGGTGCGGC
GGGCGTGGGAGCAAGTTGTTTGCGAGACGCCGGTGCTGCGGACGCGGTTTGTGCCGACGGGGTGGCGCGAGGTGC
CGTGGGTGCAGATTGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail