Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5358
Gene name
LocationContig_40:75648..76709
Strand+
Gene length (bp)1061
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20237 DUF6594 Family of unknown function (DUF6594) 6.1E-46 10 271

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22
2 230 252 22
3 259 281 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5358
MAREATPAGYAQWSSWIASDRDGEGFVFRRFDGLAATNLLYLQSDMMEVEQRLEAMNQEATGSTNMAAIAETCNW
EALLEHCQPNHPRYTEAKKRMDLILELRLKIKEYHEALLLQSRLAQLQRPGARVIGALNDMMRQDAIPKIGGKAK
QYLQDENDLVALGSPAQEDYLSQFLRRRLARTDTSLEPAMPRVARFDESTINTILNIVTIATATFSLVGPIVTLY
LIQTHWLKLMLVAVFTLSFAASVAVVTKAKRPEIFVGTATYAAVLVVFISSGSLTGG*
Coding >OphauB2|5358
ATGGCTCGAGAGGCGACACCCGCAGGCTATGCGCAGTGGTCCTCCTGGATTGCTTCTGACCGGGATGGCGAGGGC
TTCGTCTTCCGCAGGTTTGATGGCCTGGCAGCCACCAATCTCTTGTACCTTCAAAGCGACATGATGGAGGTTGAG
CAGCGTCTAGAAGCCATGAATCAAGAGGCTACTGGAAGCACAAACATGGCTGCAATAGCCGAGACGTGTAATTGG
GAGGCTTTGCTAGAGCACTGCCAGCCAAACCACCCTCGATATACAGAGGCAAAGAAGAGAATGGACCTGATACTT
GAGTTGAGATTGAAAATAAAAGAATACCATGAAGCTCTGTTGCTGCAAAGTCGCTTGGCACAGCTGCAACGTCCC
GGTGCTAGAGTCATTGGGGCACTGAATGACATGATGAGGCAGGACGCTATTCCCAAGATTGGTGGCAAGGCAAAA
CAATATCTGCAAGACGAAAACGATCTTGTAGCCCTGGGCAGCCCAGCTCAAGAAGATTATCTCTCGCAATTTCTA
AGAAGAAGACTTGCGCGTACCGATACGAGTTTGGAGCCTGCAATGCCGCGAGTAGCGCGATTTGACGAATCCACC
ATTAATACTATCCTCAACATTGTCACCATTGCCACTGCCACTTTTTCCCTTGTTGGACCCATTGTTACACTGTAC
CTCATACAGACCCATTGGCTCAAGCTCATGCTTGTTGCCGTCTTTACTCTGAGTTTTGCGGCTAGTGTGGCAGTG
GTGACGAAAGCTAAGAGGCCAGAGATATTCGTTGGCACGGCAACATACGCCGCTGTACTTGTCGTCTTTATCAGT
AGCGGGAGTCTGACTGGGGGTTAA
Transcript >OphauB2|5358
ATGGCTCGAGAGGCGACACCCGCAGGCTATGCGCAGTGGTCCTCCTGGATTGCTTCTGACCGGGATGGCGAGGGC
TTCGTCTTCCGCAGGTTTGATGGCCTGGCAGCCACCAATCTCTTGTACCTTCAAAGCGACATGATGGAGGTTGAG
CAGCGTCTAGAAGCCATGAATCAAGAGGCTACTGGAAGCACAAACATGGCTGCAATAGCCGAGACGTGTAATTGG
GAGGCTTTGCTAGAGCACTGCCAGCCAAACCACCCTCGATATACAGAGGCAAAGAAGAGAATGGACCTGATACTT
GAGTTGAGATTGAAAATAAAAGAATACCATGAAGCTCTGTTGCTGCAAAGTCGCTTGGCACAGCTGCAACGTCCC
GGTGCTAGAGTCATTGGGGCACTGAATGACATGATGAGGCAGGACGCTATTCCCAAGATTGGTGGCAAGGCAAAA
CAATATCTGCAAGACGAAAACGATCTTGTAGCCCTGGGCAGCCCAGCTCAAGAAGATTATCTCTCGCAATTTCTA
AGAAGAAGACTTGCGCGTACCGATACGAGTTTGGAGCCTGCAATGCCGCGAGTAGCGCGATTTGACGAATCCACC
ATTAATACTATCCTCAACATTGTCACCATTGCCACTGCCACTTTTTCCCTTGTTGGACCCATTGTTACACTGTAC
CTCATACAGACCCATTGGCTCAAGCTCATGCTTGTTGCCGTCTTTACTCTGAGTTTTGCGGCTAGTGTGGCAGTG
GTGACGAAAGCTAAGAGGCCAGAGATATTCGTTGGCACGGCAACATACGCCGCTGTACTTGTCGTCTTTATCAGT
AGCGGGAGTCTGACTGGGGGTTAA
Gene >OphauB2|5358
ATGGCTCGAGAGGCGACACCCGCAGGCTATGCGCAGTGGTCCTCCTGGATTGCTTCTGACCGGGATGGCGAGGGC
TTCGTCTTCCGCAGGTTTGATGGCCTGGCAGCCACCAATCTCTTGTACCTTCAAAGCGACATGATGGAGGTTGAG
CAGCGTCTAGAAGCCATGAATCAAGAGGCTACTGGAAGCACAAACATGGCTGCAATAGCCGAGACGTGTAATTGG
GAGGCTTTGCTAGAGCACTGCCAGCCAAACCACCCTCGATATACAGAGGCAAAGAAGAGAATGGACCTGATACTT
GAGTTGAGATTGAAAATAAAAGAATACCGTACGTAATACCCTCTACTCTTGAAATCTAGCAGCAAACAGTCGCTC
CGCGTAGTGCTGTGCTGAGTTTAATAGATGAAGCTCTGTTGCTGCAAAGTCGCTTGGCACAGCTGCAACGTCCCG
GTGCTAGAGTCATTGGGGCACTGAATGACATGATGAGGCAGGACGCTATTCCCAAGATTGGTGGCAAGGCAAAAC
AATATCTGCAAGACGAAAACGATCTTGTAGCCCTGGGCAGCCCAGCTCAAGAAGATTATCTCTCGCAATTTCTAA
GAAGAAGACTTGCGCGTACCGTACGCCATCACATAAACACCCCTTGTTTCTATCAGACTTGAAAGTTGTTGCGCA
TAGGCTAACAGCGTGTCCCCAGGATACGAGTTTGGAGCCTGCAATGCCGCGAGTAGCGCGATTTGACGAATCCAC
CATTAATACTATCCTCAACATTGTCACCATTGCCACTGCCACTTTTTCCCTTGTTGGACCCATTGTTACACTGTA
CCTCATACAGACCCATTGGCTCAAGCTCATGCTTGTTGCCGTCTTTACTCTGAGTTTTGCGGCTAGTGTGGCAGT
GGTGACGAAAGCTAAGAGGCCAGAGATATTCGTTGGCACGGCAACGTGAGCGCATCTTGAATGCACCGGAGCCTT
AGGTCTCACCTGCTGACAGATGCTTGTGTAGATACGCCGCTGTACTTGTCGTCTTTATCAGTAGCGGGAGTCTGA
CTGGGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail