Protein ID | OphauB2|5348 |
Gene name | |
Location | Contig_40:44332..45490 |
Strand | - |
Gene length (bp) | 1158 |
Transcript length (bp) | 1029 |
Coding sequence length (bp) | 1029 |
Protein length (aa) | 343 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00067 | p450 | Cytochrome P450 | 4.8E-42 | 63 | 311 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 1 | 315 | 8.0E-40 |
sp|Q9QZ82|CP11A_MOUSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 | 114 | 315 | 2.0E-22 |
sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 131 | 312 | 1.0E-20 |
sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 114 | 315 | 1.0E-20 |
sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 126 | 312 | 4.0E-19 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 1 | 315 | 8.0E-40 |
sp|Q9QZ82|CP11A_MOUSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 | 114 | 315 | 2.0E-22 |
sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 131 | 312 | 1.0E-20 |
sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 114 | 315 | 1.0E-20 |
sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 126 | 312 | 4.0E-19 |
sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 140 | 338 | 2.0E-18 |
sp|Q9EPT4|CP11A_MESAU | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 | 114 | 315 | 3.0E-18 |
sp|O64989|C90B1_ARATH | Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 | 117 | 320 | 2.0E-17 |
sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 139 | 308 | 3.0E-17 |
sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 137 | 306 | 8.0E-17 |
sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 78 | 305 | 9.0E-17 |
sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 133 | 310 | 9.0E-17 |
sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 140 | 307 | 1.0E-16 |
sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 126 | 309 | 3.0E-16 |
sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 139 | 308 | 4.0E-16 |
sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 126 | 328 | 4.0E-16 |
sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 126 | 309 | 9.0E-16 |
sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 126 | 316 | 1.0E-15 |
sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 124 | 323 | 2.0E-15 |
sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 126 | 315 | 2.0E-15 |
sp|O46515|CP11A_HORSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 | 111 | 315 | 3.0E-15 |
sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 125 | 307 | 3.0E-15 |
sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 140 | 300 | 4.0E-15 |
sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 137 | 309 | 4.0E-15 |
sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 98 | 315 | 5.0E-15 |
sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 137 | 324 | 6.0E-15 |
sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 72 | 332 | 6.0E-15 |
sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 62 | 304 | 7.0E-15 |
sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 122 | 326 | 7.0E-15 |
sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 122 | 326 | 7.0E-15 |
sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 56 | 326 | 8.0E-15 |
sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 122 | 323 | 9.0E-15 |
sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 137 | 311 | 1.0E-14 |
sp|P33273|CP255_RAT | Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 | 121 | 323 | 1.0E-14 |
sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 121 | 323 | 1.0E-14 |
sp|Q9D816|CP255_MOUSE | Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 | 121 | 323 | 1.0E-14 |
sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 124 | 309 | 2.0E-14 |
sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 78 | 305 | 2.0E-14 |
sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 126 | 305 | 3.0E-14 |
sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 104 | 334 | 3.0E-14 |
sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 137 | 305 | 3.0E-14 |
sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 131 | 309 | 3.0E-14 |
sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 143 | 314 | 3.0E-14 |
sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 137 | 307 | 3.0E-14 |
sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 137 | 305 | 3.0E-14 |
sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 137 | 305 | 3.0E-14 |
sp|P05108|CP11A_HUMAN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 | 114 | 315 | 4.0E-14 |
sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 79 | 304 | 4.0E-14 |
sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 74 | 305 | 5.0E-14 |
sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 139 | 306 | 5.0E-14 |
sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 139 | 306 | 5.0E-14 |
sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 123 | 303 | 5.0E-14 |
sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 14 | 303 | 6.0E-14 |
sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 1 | 311 | 7.0E-14 |
sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 110 | 338 | 7.0E-14 |
sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 130 | 319 | 7.0E-14 |
sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 137 | 306 | 8.0E-14 |
sp|P00189|CP11A_BOVIN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 | 114 | 307 | 9.0E-14 |
sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 137 | 305 | 1.0E-13 |
sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 137 | 307 | 1.0E-13 |
sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 137 | 305 | 1.0E-13 |
sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 137 | 305 | 1.0E-13 |
sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 121 | 323 | 1.0E-13 |
sp|P79153|CP11A_CAPHI | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 | 114 | 307 | 1.0E-13 |
sp|Q2XV99|CP11A_MACFA | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 | 114 | 315 | 1.0E-13 |
sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 137 | 311 | 1.0E-13 |
sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 14 | 303 | 1.0E-13 |
sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 126 | 329 | 1.0E-13 |
sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 55 | 308 | 1.0E-13 |
sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 124 | 323 | 2.0E-13 |
sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 114 | 307 | 2.0E-13 |
sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 80 | 304 | 2.0E-13 |
sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 2 | 308 | 2.0E-13 |
sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 119 | 317 | 2.0E-13 |
sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 126 | 324 | 2.0E-13 |
sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 14 | 303 | 2.0E-13 |
sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 140 | 307 | 2.0E-13 |
sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 126 | 305 | 3.0E-13 |
sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 137 | 305 | 3.0E-13 |
sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 106 | 305 | 3.0E-13 |
sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 3.0E-13 |
sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 105 | 311 | 3.0E-13 |
sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 137 | 303 | 3.0E-13 |
sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 126 | 321 | 5.0E-13 |
sp|Q42569|C90A1_ARATH | Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 | 136 | 311 | 5.0E-13 |
sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 5.0E-13 |
sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 14 | 303 | 5.0E-13 |
sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 123 | 313 | 5.0E-13 |
sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 132 | 327 | 7.0E-13 |
sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 123 | 303 | 7.0E-13 |
sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 7.0E-13 |
sp|P24557|THAS_HUMAN | Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 | 91 | 306 | 8.0E-13 |
sp|Q64408|C11B1_CAVPO | Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 | 63 | 308 | 8.0E-13 |
sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 126 | 323 | 9.0E-13 |
sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 57 | 308 | 9.0E-13 |
sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 126 | 306 | 1.0E-12 |
sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 137 | 305 | 1.0E-12 |
sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 1.0E-12 |
sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 132 | 308 | 1.0E-12 |
sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 137 | 308 | 1.0E-12 |
sp|Q9V676|CP6T3_DROME | Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 | 137 | 303 | 1.0E-12 |
sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 123 | 309 | 1.0E-12 |
sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 40 | 303 | 2.0E-12 |
sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 122 | 305 | 2.0E-12 |
sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 124 | 323 | 2.0E-12 |
sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 38 | 308 | 2.0E-12 |
sp|Q9V769|C6A22_DROME | Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 | 143 | 308 | 2.0E-12 |
sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 140 | 306 | 2.0E-12 |
sp|P9WPN1|C135A_MYCTU | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 | 173 | 308 | 2.0E-12 |
sp|P9WPN0|C135A_MYCTO | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 | 173 | 308 | 2.0E-12 |
sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 124 | 323 | 2.0E-12 |
sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 137 | 319 | 2.0E-12 |
sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 122 | 323 | 2.0E-12 |
sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 78 | 323 | 2.0E-12 |
sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 126 | 311 | 2.0E-12 |
sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 143 | 328 | 2.0E-12 |
sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 136 | 305 | 2.0E-12 |
sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 118 | 323 | 2.0E-12 |
sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 121 | 307 | 2.0E-12 |
sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 131 | 300 | 2.0E-12 |
sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 126 | 323 | 2.0E-12 |
sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 137 | 305 | 2.0E-12 |
sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 126 | 328 | 2.0E-12 |
sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 2.0E-12 |
sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 78 | 323 | 3.0E-12 |
sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 123 | 311 | 3.0E-12 |
sp|Q50EK6|C72B1_PINTA | Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1 | 82 | 309 | 3.0E-12 |
sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 9 | 306 | 3.0E-12 |
sp|Q9VRI9|CP6T1_DROME | Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 | 143 | 312 | 3.0E-12 |
sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 111 | 306 | 3.0E-12 |
sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 130 | 303 | 4.0E-12 |
sp|P24454|CP2A8_MESAU | Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 | 123 | 323 | 5.0E-12 |
sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 126 | 323 | 5.0E-12 |
sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 128 | 303 | 5.0E-12 |
sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 114 | 306 | 5.0E-12 |
sp|Q9UVC3|CP51_CUNEL | Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 | 132 | 320 | 6.0E-12 |
sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 128 | 303 | 6.0E-12 |
sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 130 | 309 | 6.0E-12 |
sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 130 | 303 | 6.0E-12 |
sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 130 | 309 | 6.0E-12 |
sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 78 | 305 | 6.0E-12 |
sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 111 | 315 | 6.0E-12 |
sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 137 | 303 | 7.0E-12 |
sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 87 | 315 | 7.0E-12 |
sp|O55127|CP26A_MOUSE | Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 | 85 | 309 | 7.0E-12 |
sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 137 | 323 | 7.0E-12 |
sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 130 | 338 | 7.0E-12 |
sp|H2KYS3|DAF9_CAEEL | Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 | 137 | 340 | 7.0E-12 |
sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 130 | 305 | 7.0E-12 |
sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 124 | 323 | 7.0E-12 |
sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 124 | 323 | 8.0E-12 |
sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 137 | 305 | 9.0E-12 |
sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 134 | 303 | 9.0E-12 |
sp|P56657|CP240_MOUSE | Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 | 126 | 323 | 9.0E-12 |
sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 137 | 305 | 9.0E-12 |
sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 137 | 314 | 9.0E-12 |
sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 100 | 338 | 1.0E-11 |
sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 57 | 307 | 1.0E-11 |
sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 137 | 304 | 1.0E-11 |
sp|P05178|CP2C6_RAT | Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 | 121 | 323 | 1.0E-11 |
sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 133 | 324 | 1.0E-11 |
sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 86 | 308 | 1.0E-11 |
sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 57 | 324 | 1.0E-11 |
sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 78 | 313 | 1.0E-11 |
sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 140 | 306 | 1.0E-11 |
sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 68 | 323 | 1.0E-11 |
sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 130 | 311 | 1.0E-11 |
sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 130 | 307 | 1.0E-11 |
sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 130 | 307 | 1.0E-11 |
sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 130 | 307 | 1.0E-11 |
sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 140 | 315 | 1.0E-11 |
sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 137 | 307 | 1.0E-11 |
sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 11 | 303 | 1.0E-11 |
sp|Q43147|C85A1_SOLLC | Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 | 101 | 311 | 2.0E-11 |
sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 137 | 306 | 2.0E-11 |
sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 140 | 305 | 2.0E-11 |
sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 90 | 311 | 2.0E-11 |
sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 124 | 303 | 2.0E-11 |
sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 133 | 319 | 2.0E-11 |
sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 57 | 310 | 2.0E-11 |
sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 128 | 305 | 2.0E-11 |
sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 85 | 313 | 2.0E-11 |
sp|Q8GSQ1|C85A1_ORYSJ | Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 | 82 | 306 | 2.0E-11 |
sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 59 | 340 | 2.0E-11 |
sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 136 | 306 | 2.0E-11 |
sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 130 | 305 | 2.0E-11 |
sp|Q7KWN2|C525A_DICDI | Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 | 80 | 313 | 2.0E-11 |
sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 130 | 305 | 2.0E-11 |
sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 117 | 303 | 2.0E-11 |
sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 139 | 315 | 2.0E-11 |
sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 134 | 323 | 2.0E-11 |
sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 130 | 317 | 2.0E-11 |
sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 78 | 305 | 2.0E-11 |
sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 134 | 316 | 3.0E-11 |
sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 137 | 309 | 3.0E-11 |
sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 121 | 311 | 3.0E-11 |
sp|P00180|CP2C1_RABIT | Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 | 124 | 303 | 3.0E-11 |
sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 136 | 303 | 3.0E-11 |
sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 2 | 309 | 3.0E-11 |
sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 138 | 304 | 3.0E-11 |
sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 143 | 309 | 3.0E-11 |
sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 134 | 316 | 3.0E-11 |
sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 130 | 303 | 3.0E-11 |
sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 137 | 307 | 3.0E-11 |
sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 130 | 308 | 3.0E-11 |
sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 130 | 324 | 3.0E-11 |
sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 137 | 305 | 4.0E-11 |
sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 91 | 306 | 4.0E-11 |
sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 126 | 311 | 4.0E-11 |
sp|Q54SK0|C508B_DICDI | Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 | 137 | 326 | 4.0E-11 |
sp|Q50LE0|C85A3_SOLLC | Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 | 101 | 306 | 4.0E-11 |
sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 130 | 308 | 4.0E-11 |
sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 108 | 308 | 4.0E-11 |
sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 140 | 309 | 4.0E-11 |
sp|Q9VRB3|CP6V1_DROME | Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 | 140 | 309 | 4.0E-11 |
sp|P10612|CP11A_PIG | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 | 114 | 307 | 5.0E-11 |
sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 126 | 326 | 5.0E-11 |
sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 134 | 311 | 5.0E-11 |
sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 117 | 303 | 5.0E-11 |
sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 87 | 315 | 5.0E-11 |
sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 55 | 308 | 5.0E-11 |
sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 137 | 305 | 5.0E-11 |
sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 124 | 303 | 6.0E-11 |
sp|Q9AXH9|KAO1_HORVU | Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 | 123 | 313 | 6.0E-11 |
sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 136 | 331 | 6.0E-11 |
sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 121 | 311 | 6.0E-11 |
sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 123 | 313 | 6.0E-11 |
sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 137 | 304 | 6.0E-11 |
sp|Q69F95|C85A_PHAVU | Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 | 101 | 311 | 6.0E-11 |
sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 73 | 303 | 6.0E-11 |
sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 128 | 305 | 7.0E-11 |
sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 126 | 330 | 7.0E-11 |
sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 59 | 340 | 8.0E-11 |
sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 104 | 309 | 8.0E-11 |
sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 86 | 308 | 8.0E-11 |
sp|P90771|C36A1_CAEEL | Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 | 99 | 303 | 8.0E-11 |
sp|P97720|C11B1_MESAU | Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 | 126 | 315 | 8.0E-11 |
sp|Q9FMA5|C85A1_ARATH | Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 | 126 | 317 | 9.0E-11 |
sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 130 | 303 | 9.0E-11 |
sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 55 | 336 | 9.0E-11 |
sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 137 | 309 | 9.0E-11 |
sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 140 | 305 | 9.0E-11 |
sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 95 | 306 | 9.0E-11 |
sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 130 | 313 | 1.0E-10 |
sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 137 | 305 | 1.0E-10 |
sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 134 | 307 | 1.0E-10 |
sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 126 | 307 | 1.0E-10 |
sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 143 | 306 | 1.0E-10 |
sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 184 | 308 | 1.0E-10 |
sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 117 | 309 | 1.0E-10 |
sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 57 | 329 | 1.0E-10 |
sp|Q6F4F5|C724B_ORYSJ | Cytochrome P450 724B1 OS=Oryza sativa subsp. japonica GN=CYP724B1 PE=1 SV=1 | 140 | 317 | 1.0E-10 |
sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 130 | 304 | 1.0E-10 |
sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 132 | 308 | 1.0E-10 |
sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 137 | 303 | 1.0E-10 |
sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 130 | 305 | 1.0E-10 |
sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 126 | 303 | 1.0E-10 |
sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 59 | 340 | 1.0E-10 |
sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 57 | 323 | 1.0E-10 |
sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 137 | 305 | 1.0E-10 |
sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 126 | 322 | 1.0E-10 |
sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 132 | 308 | 2.0E-10 |
sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 140 | 325 | 2.0E-10 |
sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 137 | 303 | 2.0E-10 |
sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 137 | 307 | 2.0E-10 |
sp|P19099|C11B2_HUMAN | Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 | 124 | 284 | 2.0E-10 |
sp|Q29478|CP2CV_CAPHE | Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 | 124 | 330 | 2.0E-10 |
sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 137 | 329 | 2.0E-10 |
sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 137 | 313 | 2.0E-10 |
sp|Q54F47|C513C_DICDI | Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 | 137 | 305 | 2.0E-10 |
sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 140 | 307 | 2.0E-10 |
sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 123 | 303 | 2.0E-10 |
sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 85 | 338 | 2.0E-10 |
sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 140 | 307 | 2.0E-10 |
sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 95 | 306 | 2.0E-10 |
sp|P20814|CP2CD_RAT | Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 | 126 | 323 | 2.0E-10 |
sp|Q50EK5|C72B2_PINTA | Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1 | 137 | 317 | 2.0E-10 |
sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 143 | 315 | 2.0E-10 |
sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 105 | 309 | 2.0E-10 |
sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 57 | 323 | 2.0E-10 |
sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 126 | 306 | 2.0E-10 |
sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 128 | 306 | 2.0E-10 |
sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 124 | 335 | 2.0E-10 |
sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 139 | 312 | 2.0E-10 |
sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 139 | 312 | 2.0E-10 |
sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 57 | 307 | 2.0E-10 |
sp|P15538|C11B1_HUMAN | Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 | 63 | 284 | 2.0E-10 |
sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 135 | 308 | 2.0E-10 |
sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 135 | 308 | 3.0E-10 |
sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 128 | 303 | 3.0E-10 |
sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 140 | 304 | 3.0E-10 |
sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 124 | 323 | 3.0E-10 |
sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 11 | 303 | 3.0E-10 |
sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 137 | 303 | 3.0E-10 |
sp|Q9LMX7|C78A5_ARATH | Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 | 137 | 319 | 3.0E-10 |
sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 57 | 305 | 3.0E-10 |
sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 139 | 312 | 3.0E-10 |
sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 165 | 310 | 3.0E-10 |
sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 55 | 308 | 3.0E-10 |
sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 103 | 303 | 3.0E-10 |
sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 140 | 315 | 4.0E-10 |
sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 11 | 303 | 4.0E-10 |
sp|F4IK45|C70B2_ARATH | Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 | 57 | 308 | 4.0E-10 |
sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 57 | 323 | 4.0E-10 |
sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 130 | 305 | 4.0E-10 |
sp|Q8L7D5|THAH_ARATH | Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 | 134 | 309 | 4.0E-10 |
sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 126 | 319 | 4.0E-10 |
sp|Q1ZXG6|C5131_DICDI | Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 | 192 | 305 | 4.0E-10 |
sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 126 | 306 | 4.0E-10 |
sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 108 | 303 | 4.0E-10 |
sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 140 | 305 | 4.0E-10 |
sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 134 | 305 | 5.0E-10 |
sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 130 | 304 | 5.0E-10 |
sp|O93323|CP26A_XENLA | Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 | 89 | 309 | 5.0E-10 |
sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 11 | 303 | 5.0E-10 |
sp|I7C6E8|C7A52_PANGI | Beta-amyrin 28-oxidase OS=Panax ginseng PE=2 SV=1 | 111 | 316 | 5.0E-10 |
sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 60 | 304 | 6.0E-10 |
sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 90 | 304 | 6.0E-10 |
sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 130 | 305 | 6.0E-10 |
sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 124 | 318 | 6.0E-10 |
sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 140 | 306 | 6.0E-10 |
sp|Q29527|C11B1_PAPHU | Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 | 63 | 284 | 6.0E-10 |
sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 134 | 327 | 6.0E-10 |
sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 126 | 305 | 7.0E-10 |
sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 140 | 306 | 7.0E-10 |
sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 62 | 303 | 7.0E-10 |
sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 134 | 309 | 7.0E-10 |
sp|Q6UEG2|AFLN_ASPPA | P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 | 57 | 335 | 7.0E-10 |
sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 72 | 307 | 7.0E-10 |
sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 167 | 310 | 7.0E-10 |
sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 137 | 309 | 8.0E-10 |
sp|Q04552|CP6B1_PAPPO | Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 | 130 | 288 | 8.0E-10 |
sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 123 | 307 | 9.0E-10 |
sp|O23051|KAO1_ARATH | Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 | 140 | 304 | 9.0E-10 |
sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 124 | 303 | 9.0E-10 |
sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 130 | 305 | 9.0E-10 |
sp|O43174|CP26A_HUMAN | Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 | 85 | 309 | 1.0E-09 |
sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 124 | 309 | 1.0E-09 |
sp|Q64658|C11B2_MESAU | Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 | 59 | 311 | 1.0E-09 |
sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 126 | 291 | 1.0E-09 |
sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 140 | 309 | 1.0E-09 |
sp|Q7XU38|C87A3_ORYSJ | Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 | 137 | 305 | 1.0E-09 |
sp|Q1ZXL2|C518B_DICDI | Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 | 137 | 327 | 1.0E-09 |
sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 59 | 340 | 1.0E-09 |
sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 59 | 340 | 1.0E-09 |
sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 123 | 307 | 1.0E-09 |
sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 140 | 307 | 1.0E-09 |
sp|Q940V4|C85A2_ARATH | Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1 | 126 | 317 | 1.0E-09 |
sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 128 | 307 | 1.0E-09 |
sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 130 | 305 | 1.0E-09 |
sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 184 | 307 | 1.0E-09 |
sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 124 | 319 | 1.0E-09 |
sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 182 | 305 | 1.0E-09 |
sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 57 | 323 | 1.0E-09 |
sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 137 | 303 | 1.0E-09 |
sp|O13820|ERG5_SCHPO | Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 | 140 | 297 | 1.0E-09 |
sp|Q43246|C88A1_MAIZE | Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 | 140 | 313 | 1.0E-09 |
sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 130 | 312 | 1.0E-09 |
sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 126 | 310 | 1.0E-09 |
sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 137 | 305 | 2.0E-09 |
sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 128 | 305 | 2.0E-09 |
sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 189 | 327 | 2.0E-09 |
sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 140 | 307 | 2.0E-09 |
sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 128 | 317 | 2.0E-09 |
sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 161 | 309 | 2.0E-09 |
sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 137 | 303 | 2.0E-09 |
sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 130 | 307 | 2.0E-09 |
sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 117 | 309 | 2.0E-09 |
sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 134 | 317 | 2.0E-09 |
sp|Q9ZW95|C7352_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 | 166 | 310 | 2.0E-09 |
sp|P79739|CP26A_DANRE | Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 | 126 | 309 | 2.0E-09 |
sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 140 | 322 | 2.0E-09 |
sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 123 | 308 | 2.0E-09 |
sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 86 | 308 | 2.0E-09 |
sp|O42457|CP1A1_SPAAU | Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 | 67 | 317 | 3.0E-09 |
sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 121 | 330 | 3.0E-09 |
sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 57 | 317 | 3.0E-09 |
sp|Q9W130|CP9C1_DROME | Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 | 139 | 328 | 3.0E-09 |
sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 182 | 305 | 3.0E-09 |
sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 118 | 309 | 3.0E-09 |
sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 126 | 307 | 3.0E-09 |
sp|Q9DBX6|CP2S1_MOUSE | Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 | 93 | 306 | 3.0E-09 |
sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 137 | 309 | 3.0E-09 |
sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 85 | 304 | 3.0E-09 |
sp|P30100|C11B3_RAT | Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 | 63 | 291 | 3.0E-09 |
sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 57 | 318 | 3.0E-09 |
sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 121 | 330 | 3.0E-09 |
sp|P30099|C11B2_RAT | Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 | 63 | 291 | 4.0E-09 |
sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 2 | 308 | 4.0E-09 |
sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 140 | 303 | 4.0E-09 |
sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 115 | 313 | 4.0E-09 |
sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 183 | 315 | 4.0E-09 |
sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 128 | 317 | 4.0E-09 |
sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 128 | 309 | 4.0E-09 |
sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 137 | 304 | 5.0E-09 |
sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 126 | 310 | 5.0E-09 |
sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 139 | 307 | 5.0E-09 |
sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 126 | 310 | 5.0E-09 |
sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 130 | 304 | 5.0E-09 |
sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 130 | 313 | 6.0E-09 |
sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 27 | 327 | 6.0E-09 |
sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 137 | 307 | 6.0E-09 |
sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 128 | 309 | 6.0E-09 |
sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 68 | 309 | 6.0E-09 |
sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 123 | 310 | 6.0E-09 |
sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 137 | 307 | 6.0E-09 |
sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 130 | 307 | 6.0E-09 |
sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 27 | 327 | 7.0E-09 |
sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 60 | 318 | 7.0E-09 |
sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 42 | 308 | 7.0E-09 |
sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 140 | 315 | 7.0E-09 |
sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 137 | 305 | 7.0E-09 |
sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 86 | 308 | 7.0E-09 |
sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 137 | 307 | 7.0E-09 |
sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 123 | 317 | 7.0E-09 |
sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 57 | 317 | 7.0E-09 |
sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 126 | 315 | 7.0E-09 |
sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 111 | 316 | 8.0E-09 |
sp|I3PFJ5|C76AD_BETVU | Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 | 124 | 327 | 8.0E-09 |
sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 137 | 306 | 8.0E-09 |
sp|Q9SAE4|C71BT_ARATH | Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 | 126 | 326 | 8.0E-09 |
sp|Q28827|CP11A_RABIT | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Oryctolagus cuniculus GN=CYP11A1 PE=2 SV=1 | 114 | 269 | 8.0E-09 |
sp|Q12585|CP52T_CANMA | Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 | 137 | 291 | 9.0E-09 |
sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 140 | 322 | 9.0E-09 |
sp|P11372|CP2CF_RABIT | Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 | 161 | 323 | 9.0E-09 |
sp|Q9T093|C70B3_ARATH | Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 | 118 | 308 | 9.0E-09 |
sp|P30611|CP52N_CANTR | Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 | 70 | 303 | 9.0E-09 |
sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 137 | 327 | 9.0E-09 |
sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 130 | 287 | 1.0E-08 |
sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 137 | 305 | 1.0E-08 |
sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 103 | 327 | 1.0E-08 |
sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 126 | 308 | 1.0E-08 |
sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 123 | 307 | 1.0E-08 |
sp|O42231|CP1A1_LIZAU | Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 | 57 | 305 | 1.0E-08 |
sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 76 | 315 | 1.0E-08 |
sp|Q08D50|CP26B_XENTR | Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 | 123 | 318 | 1.0E-08 |
sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 130 | 305 | 1.0E-08 |
sp|Q5KQT7|CP1A1_FELCA | Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 | 57 | 318 | 1.0E-08 |
sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 75 | 303 | 1.0E-08 |
sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 137 | 309 | 1.0E-08 |
sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 137 | 305 | 1.0E-08 |
sp|O64698|C7102_ARATH | Cytochrome P450 710A2 OS=Arabidopsis thaliana GN=CYP710A2 PE=2 SV=1 | 115 | 311 | 1.0E-08 |
sp|Q12664|CP51_PENIT | Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 | 128 | 305 | 1.0E-08 |
sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 136 | 326 | 1.0E-08 |
sp|Q54SN0|C513E_DICDI | Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 | 136 | 305 | 1.0E-08 |
sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 128 | 308 | 1.0E-08 |
sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 132 | 307 | 1.0E-08 |
sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 133 | 305 | 2.0E-08 |
sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 128 | 308 | 2.0E-08 |
sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 128 | 308 | 2.0E-08 |
sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 187 | 310 | 2.0E-08 |
sp|Q9LJK2|ABAH4_ARATH | Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 | 126 | 311 | 2.0E-08 |
sp|P92994|TCMO_ARATH | Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 | 77 | 303 | 2.0E-08 |
sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 123 | 305 | 2.0E-08 |
sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 133 | 308 | 2.0E-08 |
sp|Q91W64|CP270_MOUSE | Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 | 124 | 303 | 2.0E-08 |
sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 136 | 306 | 2.0E-08 |
sp|P37121|C76A1_SOLME | Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 | 134 | 307 | 2.0E-08 |
sp|Q09736|CP51_SCHPO | Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 | 131 | 307 | 2.0E-08 |
sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 123 | 305 | 2.0E-08 |
sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 136 | 304 | 2.0E-08 |
sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 126 | 319 | 2.0E-08 |
sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 130 | 316 | 2.0E-08 |
sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 134 | 308 | 2.0E-08 |
sp|Q64403|CP2DG_CAVPO | Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 | 98 | 313 | 2.0E-08 |
sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 126 | 311 | 2.0E-08 |
sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 128 | 305 | 2.0E-08 |
sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 137 | 329 | 2.0E-08 |
sp|P9WPM3|CP138_MYCTU | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 | 126 | 306 | 2.0E-08 |
sp|P9WPM2|CP138_MYCTO | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 | 126 | 306 | 2.0E-08 |
sp|P63718|CP138_MYCBO | Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 | 126 | 306 | 2.0E-08 |
sp|Q9M066|C90C1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 | 106 | 312 | 2.0E-08 |
sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 116 | 303 | 2.0E-08 |
sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 137 | 303 | 2.0E-08 |
sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 87 | 309 | 3.0E-08 |
sp|Q92111|CP19A_ICTPU | Aromatase OS=Ictalurus punctatus GN=cyp19a1 PE=2 SV=1 | 124 | 327 | 3.0E-08 |
sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 124 | 309 | 3.0E-08 |
sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 84 | 304 | 3.0E-08 |
sp|P10610|CP2G1_RAT | Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 | 121 | 320 | 3.0E-08 |
sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 137 | 315 | 3.0E-08 |
sp|Q43240|TCMO_ZINVI | Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 | 139 | 303 | 3.0E-08 |
sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 126 | 306 | 3.0E-08 |
sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 130 | 303 | 3.0E-08 |
sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 130 | 303 | 3.0E-08 |
sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 137 | 308 | 3.0E-08 |
sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 133 | 304 | 3.0E-08 |
sp|Q9VJ71|CP310_DROME | Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 | 126 | 340 | 3.0E-08 |
sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 105 | 326 | 3.0E-08 |
sp|Q9C788|C70B1_ARATH | Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 | 111 | 307 | 3.0E-08 |
sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 140 | 315 | 3.0E-08 |
sp|O49396|C82C3_ARATH | Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | 136 | 303 | 3.0E-08 |
sp|Q94IA6|C90D1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=CYP90D1 PE=2 SV=1 | 191 | 311 | 3.0E-08 |
sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 126 | 303 | 3.0E-08 |
sp|P48522|TCMO_CATRO | Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 | 134 | 303 | 3.0E-08 |
sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 122 | 307 | 3.0E-08 |
sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 123 | 307 | 4.0E-08 |
sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 143 | 305 | 4.0E-08 |
sp|P37124|C77A2_SOLME | Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 | 140 | 303 | 4.0E-08 |
sp|P12939|CP2DA_RAT | Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 | 184 | 326 | 4.0E-08 |
sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 58 | 323 | 4.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004497 | monooxygenase activity | Yes |
GO:0020037 | heme binding | Yes |
GO:0005506 | iron ion binding | Yes |
GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
GO:0003824 | catalytic activity | No |
GO:0046872 | metal ion binding | No |
GO:0046906 | tetrapyrrole binding | No |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0016491 | oxidoreductase activity | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0043167 | ion binding | No |
GO:0046914 | transition metal ion binding | No |
GO:0043169 | cation binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|5348 MLNIGCATSAFTRDVGIEFILGKIYGSMKKTDFDLNLAKVYQRAGLIWRITKHIRWFGPVMRFLPNPIIDWLCDE SLKSMITFCENTKARIRETVASDTGLIPDETPSQTITHAILHSNLPPEEKTMKRIQHEIRAMVAAASETTAQTMR LVIYYVYSDIKILSKLRAEIRAATAPHIQDGTLDLANLEKLPFLTAILMEGLRLSPGVVTRLARISPDSDLFYKQ WRIPAGTPTGMTALLMHLDEELFPEPTRFNPSRWSSDEVQKSTHKNWAPFSRGTRMCLGMHLAWAELYMLIASLV MRFNFDLADTDLRDVVPVSDNFAVGVRDFCGVKAYVTKYEET* |
Coding | >OphauB2|5348 ATGTTGAACATTGGATGTGCAACCAGTGCCTTCACCCGCGATGTGGGCATAGAATTCATCCTTGGAAAAATCTAC GGGAGTATGAAGAAGACAGACTTTGATTTGAACTTGGCCAAGGTCTACCAACGTGCCGGTTTAATATGGAGAATC ACGAAGCATATACGTTGGTTCGGCCCAGTCATGAGGTTTCTTCCTAATCCAATCATCGATTGGCTATGTGATGAA AGTTTGAAGAGCATGATTACCTTTTGCGAGAACACCAAGGCTAGGATTAGAGAGACTGTAGCTTCCGATACCGGG TTGATACCCGACGAAACACCTAGTCAGACCATCACACACGCGATTCTTCATTCTAATCTCCCACCCGAAGAAAAG ACGATGAAACGTATTCAACATGAAATCAGGGCCATGGTTGCCGCCGCTTCTGAGACTACGGCCCAAACAATGCGT CTAGTGATATACTACGTATACAGCGACATCAAGATTCTCAGCAAACTCCGCGCAGAGATTCGAGCTGCGACAGCT CCCCACATTCAAGATGGTACCCTCGACTTGGCTAATCTCGAAAAGTTGCCTTTTCTCACGGCCATCTTGATGGAA GGGTTGAGACTAAGCCCGGGAGTTGTCACGCGCCTGGCGCGTATTTCGCCAGACAGTGATTTGTTTTACAAGCAG TGGCGAATCCCTGCAGGCACCCCGACTGGCATGACTGCCCTGTTGATGCATTTGGATGAGGAACTGTTTCCAGAG CCTACAAGATTCAACCCCAGCAGATGGTCGAGTGATGAAGTCCAGAAAAGTACACACAAAAACTGGGCACCGTTT AGCAGGGGGACTAGAATGTGTCTCGGCATGCACCTCGCGTGGGCTGAGCTATACATGCTTATTGCCTCCTTGGTT ATGCGCTTCAACTTTGACCTCGCTGATACTGATCTCAGAGACGTTGTGCCGGTAAGTGACAATTTTGCTGTTGGG GTTCGCGATTTTTGCGGCGTCAAAGCATACGTGACGAAATATGAGGAGACATAA |
Transcript | >OphauB2|5348 ATGTTGAACATTGGATGTGCAACCAGTGCCTTCACCCGCGATGTGGGCATAGAATTCATCCTTGGAAAAATCTAC GGGAGTATGAAGAAGACAGACTTTGATTTGAACTTGGCCAAGGTCTACCAACGTGCCGGTTTAATATGGAGAATC ACGAAGCATATACGTTGGTTCGGCCCAGTCATGAGGTTTCTTCCTAATCCAATCATCGATTGGCTATGTGATGAA AGTTTGAAGAGCATGATTACCTTTTGCGAGAACACCAAGGCTAGGATTAGAGAGACTGTAGCTTCCGATACCGGG TTGATACCCGACGAAACACCTAGTCAGACCATCACACACGCGATTCTTCATTCTAATCTCCCACCCGAAGAAAAG ACGATGAAACGTATTCAACATGAAATCAGGGCCATGGTTGCCGCCGCTTCTGAGACTACGGCCCAAACAATGCGT CTAGTGATATACTACGTATACAGCGACATCAAGATTCTCAGCAAACTCCGCGCAGAGATTCGAGCTGCGACAGCT CCCCACATTCAAGATGGTACCCTCGACTTGGCTAATCTCGAAAAGTTGCCTTTTCTCACGGCCATCTTGATGGAA GGGTTGAGACTAAGCCCGGGAGTTGTCACGCGCCTGGCGCGTATTTCGCCAGACAGTGATTTGTTTTACAAGCAG TGGCGAATCCCTGCAGGCACCCCGACTGGCATGACTGCCCTGTTGATGCATTTGGATGAGGAACTGTTTCCAGAG CCTACAAGATTCAACCCCAGCAGATGGTCGAGTGATGAAGTCCAGAAAAGTACACACAAAAACTGGGCACCGTTT AGCAGGGGGACTAGAATGTGTCTCGGCATGCACCTCGCGTGGGCTGAGCTATACATGCTTATTGCCTCCTTGGTT ATGCGCTTCAACTTTGACCTCGCTGATACTGATCTCAGAGACGTTGTGCCGGTAAGTGACAATTTTGCTGTTGGG GTTCGCGATTTTTGCGGCGTCAAAGCATACGTGACGAAATATGAGGAGACATAA |
Gene | >OphauB2|5348 ATGTTGAACATTGGATGTGCAACCAGTGCCTTCACCCGCGATGTGGGCATAGAATTCATCCTTGGAAAAATCTAC GGGAGTATGAAGAAGACAGACTTTGATTTGAACTTGGCCAAGGTCTACCAACGTGCCGGTTTAATATGGAGAATC ACGAAGCATATACGTTGGTTCGGCCCAGTCATGAGGTTTCTTCCTAATCCAATCATCGATTGGCTATGTGATGAA AGTTTGAAGAGCATGATTACCTTTTGCGAGGTATGTTTTGGTTGCAAAAACGTTGCCTCATTTGCTTGAATGCTG CTGACTATTCTTTTCAGAACACCAAGGCTAGGATTAGAGAGACTGTAGCTTCCGATACCGGGTTGATACCCGACG AAACACCTAGTCAGACCATCACACACGCGATTCTTCATTCTAATCTCCCACCCGAAGAAAAGACGATGAAACGTA TTCAACATGAAATCAGGGCCATGGTTGCCGCCGCTTCTGAGACTACGGCCCAAACAATGCGTCTAGTGATATACT ACGTATACAGCGACATCAAGATTCTCAGCAAACTCCGCGCAGAGATTCGAGCTGCGACAGCTCCCCACATTCAAG ATGGTACCCTCGACTTGGCTAATCTCGAAAAGTTGCCTTTTCTCACGGCCATCTTGATGGAAGGGTTGAGACTAA GCCCGGGAGTTGTCACGCGCCTGGCGCGTATTTCGCCAGACAGTGATTTGTTTTACAAGCAGTGGCGAATCCCTG CAGGCACCCCGACTGGCATGACTGCCCTGTTGATGCATTTGGATGAGGAACTGTTTCCAGAGCCTACAAGATTCA ACCCCAGCAGATGGTCGAGTGATGAAGTCCAGAAAAGTACACACAAAAACTGGGCACCGTTTAGCAGGGGGACTA GAATGTGTCTCGGCATGCAGTGAGTTTTGACTTTGACTCTTGAAAACTTGTTGATTTGCTGACGGTGCATTTTCG TGACCCTGCAGCCTCGCGTGGGCTGAGCTATACATGCTTATTGCCTCCTTGGTTATGCGCTTCAACTTTGACCTC GCTGATACTGATCTCAGAGACGTTGTGCCGGTAAGTGACAATTTTGCTGTTGGGGTTCGCGATTTTTGCGGCGTC AAAGCATACGTGACGAAATATGAGGAGACATAA |