Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5335
Gene name
LocationContig_40:19097..20283
Strand-
Gene length (bp)1186
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10282 Lactonase Lactonase, 7-bladed beta-propeller 1.7E-15 6 304

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38677|CMLE_NEUCR Carboxy-cis,cis-muconate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU04071 PE=1 SV=3 1 362 3.0E-148
sp|P46057|MLE_TRICU Muconate cycloisomerase 1 OS=Trichosporon cutaneum PE=1 SV=3 147 312 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5335
MPIHHLMVGTWTPPGYIFTVAFDDVAHSLELVKQTAIPENEPISWMAFSHDKKNIYGAALKNWNSFAVASPTEIS
HQTSLPLQDVRAQAPDADSRAIFLNAASVPPYAVYANPFYSFAGNGTVISVTPSGALSANDITQFELDNNSGIHG
SVFDPKGRYLYSADLSANKIWVHWRSDAALPGLQLVGKVDGPAENDHPRWVAMHPSGNYLYALMESGNRICEFAI
NKDDHLPVFTQKSFPLVPEGTERAADYRADVVALSSSAGHLFATTRGPDENAKGFVSTFALDQNGSIQRLIATMP
TDTSGGHSNAVSPADFSDEWVAIVEDVKGYLDMYRWENETLSRVARLQVDHDGFGMNAIWYD*
Coding >OphauB2|5335
ATGCCGATTCATCACCTCATGGTTGGAACGTGGACGCCGCCGGGATACATCTTTACGGTTGCCTTTGACGATGTT
GCGCATTCGCTCGAGCTGGTTAAGCAAACCGCCATTCCGGAAAACGAGCCCATTTCATGGATGGCGTTTAGTCAC
GATAAAAAAAATATATACGGCGCGGCACTCAAAAACTGGAACAGCTTTGCTGTAGCTTCGCCAACCGAAATATCT
CACCAAACATCTCTCCCGCTCCAAGACGTTCGCGCGCAGGCCCCCGACGCAGACTCGCGGGCCATTTTTTTAAAC
GCTGCGTCTGTGCCGCCGTATGCCGTTTACGCAAATCCTTTTTACTCGTTTGCTGGCAACGGCACAGTTATATCC
GTTACTCCGTCTGGTGCGCTCTCTGCAAATGATATTACCCAGTTTGAGCTGGACAACAACTCTGGTATTCACGGC
TCCGTGTTTGATCCAAAAGGTAGATATCTCTACTCGGCAGACTTGAGCGCAAACAAGATTTGGGTTCATTGGCGG
AGTGATGCTGCTCTGCCGGGGCTGCAGCTCGTTGGCAAGGTTGATGGTCCAGCGGAGAACGACCATCCTCGCTGG
GTGGCTATGCATCCGTCTGGAAATTACCTCTACGCTCTCATGGAGTCGGGGAACCGCATCTGCGAGTTTGCTATT
AATAAGGATGACCATTTACCCGTCTTTACGCAAAAGAGCTTCCCCCTCGTGCCAGAGGGTACTGAGCGGGCGGCA
GACTATCGCGCTGATGTTGTGGCTCTCTCATCGTCGGCTGGCCATCTCTTTGCTACTACGCGCGGGCCCGACGAG
AATGCAAAGGGCTTCGTCTCGACTTTTGCCCTGGATCAAAACGGCTCCATTCAGCGCCTCATTGCAACAATGCCC
ACTGACACTAGCGGCGGCCACAGCAACGCCGTCTCTCCTGCAGACTTTTCCGATGAGTGGGTTGCCATTGTCGAG
GATGTAAAGGGCTACCTCGACATGTATCGCTGGGAAAACGAGACGCTGTCACGCGTGGCTCGTCTCCAAGTCGAC
CACGATGGCTTTGGCATGAATGCCATTTGGTACGACTAG
Transcript >OphauB2|5335
ATGCCGATTCATCACCTCATGGTTGGAACGTGGACGCCGCCGGGATACATCTTTACGGTTGCCTTTGACGATGTT
GCGCATTCGCTCGAGCTGGTTAAGCAAACCGCCATTCCGGAAAACGAGCCCATTTCATGGATGGCGTTTAGTCAC
GATAAAAAAAATATATACGGCGCGGCACTCAAAAACTGGAACAGCTTTGCTGTAGCTTCGCCAACCGAAATATCT
CACCAAACATCTCTCCCGCTCCAAGACGTTCGCGCGCAGGCCCCCGACGCAGACTCGCGGGCCATTTTTTTAAAC
GCTGCGTCTGTGCCGCCGTATGCCGTTTACGCAAATCCTTTTTACTCGTTTGCTGGCAACGGCACAGTTATATCC
GTTACTCCGTCTGGTGCGCTCTCTGCAAATGATATTACCCAGTTTGAGCTGGACAACAACTCTGGTATTCACGGC
TCCGTGTTTGATCCAAAAGGTAGATATCTCTACTCGGCAGACTTGAGCGCAAACAAGATTTGGGTTCATTGGCGG
AGTGATGCTGCTCTGCCGGGGCTGCAGCTCGTTGGCAAGGTTGATGGTCCAGCGGAGAACGACCATCCTCGCTGG
GTGGCTATGCATCCGTCTGGAAATTACCTCTACGCTCTCATGGAGTCGGGGAACCGCATCTGCGAGTTTGCTATT
AATAAGGATGACCATTTACCCGTCTTTACGCAAAAGAGCTTCCCCCTCGTGCCAGAGGGTACTGAGCGGGCGGCA
GACTATCGCGCTGATGTTGTGGCTCTCTCATCGTCGGCTGGCCATCTCTTTGCTACTACGCGCGGGCCCGACGAG
AATGCAAAGGGCTTCGTCTCGACTTTTGCCCTGGATCAAAACGGCTCCATTCAGCGCCTCATTGCAACAATGCCC
ACTGACACTAGCGGCGGCCACAGCAACGCCGTCTCTCCTGCAGACTTTTCCGATGAGTGGGTTGCCATTGTCGAG
GATGTAAAGGGCTACCTCGACATGTATCGCTGGGAAAACGAGACGCTGTCACGCGTGGCTCGTCTCCAAGTCGAC
CACGATGGCTTTGGCATGAATGCCATTTGGTACGACTAG
Gene >OphauB2|5335
ATGCCGATTCATCACCTCATGGTTGGAACGTGGACGCCGCCGGGATACATCTTTACGGTTGCCTTTGACGATGTT
GCGCATTCGCTCGAGCTGGTTAAGCAAACCGCCATTCCGGAAAACGAGCCCATTTCATGGATGGCGTTTAGTGCA
AGTCTTTTTTTTTTCCTCAACAACTTCTTTATACTCTACATCTTCTTTATAATACCACGAGTAAAAAAAAAAAAG
GCTAACTTGACGAGAATAGCACGATAAAAAAAATATATACGGCGCGGCACTCAAAAACTGGAACAGCTTTGCTGT
AGCTTCGCCAACCGAAATATCTCACCAAACATCTCTCCCGCTCCAAGACGTTCGCGCGCAGGCCCCCGACGCAGA
CTCGCGGGCCATTTTTTTAAACGCTGCGTCTGTGCCGCCGTATGCCGTTTACGCAAATCCTTTTTACTCGTTTGC
TGGCAACGGCACAGTTATATCCGTTACTCCGTCTGGTGCGCTCTCTGCAAATGATATTACCCAGTTTGAGCTGGA
CAACAACTCTGGTATTCACGGCTCCGTGTTTGATCCAAAAGGTAGATATCTCTACTCGGCAGACTTGAGCGCAAA
CAAGATTTGGGTTCATTGGCGGAGTGATGCTGCTCTGCCGGGGCTGCAGCTCGTTGGCAAGGTTGATGGTCCAGC
GGAGAACGACCATCCTCGCTGGGTGGCTATGCATCCGTCTGGAAATTACCTCTACGCTCTCATGGAGTCGGGGAA
CCGCATCTGCGAGTTTGCTATTAATAAGGATGACCATTTACCCGTCTTTACGCAAAAGAGCTTCCCCCTCGTGCC
AGAGGGTACTGAGCGGGCGGCAGACTATCGCGCTGATGTTGTGGCTCTCTCATCGTCGGCTGGCCATCTCTTTGC
TACTACGCGCGGGCCCGACGAGAATGCAAAGGGCTTCGTCTCGACTTTTGCCCTGGATCAAAACGGCTCCATTCA
GCGCCTCATTGCAACAATGCCCACTGACACTAGCGGCGGCCACAGCAACGCCGTCTCTCCTGCAGACTTTTCCGA
TGAGTGGGTTGCCATTGTCGAGGATGTAAAGGGCTACCTCGACATGTATCGCTGGGAAAACGAGACGCTGTCACG
CGTGGCTCGTCTCCAAGTCGACCACGATGGCTTTGGCATGAATGCCATTTGGTACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail