Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5334
Gene name
LocationContig_40:16465..18608
Strand+
Gene length (bp)2143
Transcript length (bp)1956
Coding sequence length (bp)1956
Protein length (aa) 652

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01595 CNNM Cyclin M transmembrane N-terminal domain 5.4E-34 61 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 54 421 3.0E-155
sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 55 395 8.0E-125
sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 50 392 3.0E-68
sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 53 387 4.0E-64
sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 53 387 5.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 54 421 3.0E-155
sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 55 395 8.0E-125
sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 50 392 3.0E-68
sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 53 387 4.0E-64
sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 53 387 5.0E-64
sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 53 387 6.0E-64
sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 53 387 2.0E-62
sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 46 387 4.0E-61
sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 46 387 1.0E-60
sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 53 387 3.0E-60
sp|Q8VZI2|Y4370_ARATH DUF21 domain-containing protein At4g33700 OS=Arabidopsis thaliana GN=CBSDUF6 PE=1 SV=1 52 350 7.0E-59
sp|Q8RY60|Y1733_ARATH DUF21 domain-containing protein At1g47330 OS=Arabidopsis thaliana GN=CBSDUF7 PE=1 SV=1 52 350 8.0E-57
sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 55 359 4.0E-55
sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 25 347 6.0E-55
sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=1 SV=1 55 347 1.0E-53
sp|Q9ZQR4|Y2452_ARATH DUF21 domain-containing protein At2g14520 OS=Arabidopsis thaliana GN=CBSDUF3 PE=2 SV=2 64 350 1.0E-53
sp|Q0GA42|CNNM1_MOUSE Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=5 82 409 4.0E-35
sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 82 409 9.0E-35
sp|Q8NE01|CNNM3_HUMAN Metal transporter CNNM3 OS=Homo sapiens GN=CNNM3 PE=1 SV=1 141 387 8.0E-23
sp|Q32NY4|CNNM3_MOUSE Metal transporter CNNM3 OS=Mus musculus GN=Cnnm3 PE=1 SV=2 141 398 2.0E-22
sp|Q84R21|Y1559_ARATH DUF21 domain-containing protein At1g55930, chloroplastic OS=Arabidopsis thaliana GN=CBSDUFCH2 PE=2 SV=2 104 483 2.0E-15
sp|Q9LK65|Y3307_ARATH Putative DUF21 domain-containing protein At3g13070, chloroplastic OS=Arabidopsis thaliana GN=CBSDUFCH1 PE=3 SV=1 104 390 6.0E-15
sp|P74078|Y1254_SYNY3 UPF0053 protein sll1254 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1254 PE=3 SV=1 149 403 9.0E-15
sp|O07585|YHDP_BACSU UPF0053 protein YhdP OS=Bacillus subtilis (strain 168) GN=yhdP PE=3 SV=1 149 395 8.0E-13
sp|P54505|YQHB_BACSU UPF0053 protein YqhB OS=Bacillus subtilis (strain 168) GN=yqhB PE=3 SV=1 126 383 1.0E-12
sp|Q8K9C0|CORC_BUCAP Magnesium and cobalt efflux protein CorC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=corC PE=3 SV=1 225 383 8.0E-12
sp|P54428|YRKA_BACSU UPF0053 protein YrkA OS=Bacillus subtilis (strain 168) GN=yrkA PE=3 SV=2 142 383 2.0E-11
sp|P37908|YFJD_ECOLI UPF0053 inner membrane protein YfjD OS=Escherichia coli (strain K12) GN=yfjD PE=1 SV=5 98 376 8.0E-11
sp|P0A2L3|CORC_SALTY Magnesium and cobalt efflux protein CorC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=corC PE=1 SV=1 217 375 2.0E-09
sp|P0A2L4|CORC_SALTI Magnesium and cobalt efflux protein CorC OS=Salmonella typhi GN=corC PE=3 SV=1 217 375 2.0E-09
sp|O05241|YUGS_BACSU UPF0053 protein YugS OS=Bacillus subtilis (strain 168) GN=yugS PE=3 SV=2 142 383 4.0E-09
sp|O07589|YHDT_BACSU UPF0053 protein YhdT OS=Bacillus subtilis (strain 168) GN=yhdT PE=3 SV=1 149 383 4.0E-09
sp|P0AE80|CORC_ECO57 Magnesium and cobalt efflux protein CorC OS=Escherichia coli O157:H7 GN=corC PE=3 SV=1 231 375 5.0E-09
sp|P0AE79|CORC_ECOL6 Magnesium and cobalt efflux protein CorC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=corC PE=3 SV=1 231 375 5.0E-09
sp|P0AE78|CORC_ECOLI Magnesium and cobalt efflux protein CorC OS=Escherichia coli (strain K12) GN=corC PE=1 SV=1 231 375 5.0E-09
sp|P0AE81|CORC_SHIFL Magnesium and cobalt efflux protein CorC OS=Shigella flexneri GN=corC PE=3 SV=1 231 375 5.0E-09
sp|P57518|CORC_BUCAI Magnesium and cobalt efflux protein CorC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=corC PE=3 SV=1 225 375 5.0E-09
sp|Q54318|HLYC_BRAHO Hemolysin C OS=Brachyspira hyodysenteriae GN=tlyC PE=3 SV=1 231 376 7.0E-09
sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 357 404 1.0E-07
sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=1 SV=1 338 393 2.0E-07
sp|Q57017|Y107_HAEIN UPF0053 protein HI_0107 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0107 PE=1 SV=2 53 376 5.0E-07
sp|O05961|HLYC_RICPR Hemolysin C OS=Rickettsia prowazekii (strain Madrid E) GN=tlyC PE=2 SV=1 228 402 8.0E-07
sp|Q9KTE3|CORC_VIBCH Magnesium and cobalt efflux protein CorC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=corC PE=3 SV=1 225 375 9.0E-07
sp|A8EZU0|HLYC_RICCK Possible hemolysin C OS=Rickettsia canadensis (strain McKiel) GN=tlyC PE=3 SV=1 228 387 3.0E-06
sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 338 390 6.0E-06
sp|P75586|Y159_MYCPN UPF0053 protein MG146 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_159 PE=3 SV=1 97 383 7.0E-06
sp|A8GTI4|HLYC_RICRS Hemolysin C homolog OS=Rickettsia rickettsii (strain Sheila Smith) GN=tlyC PE=3 SV=1 228 402 7.0E-06
sp|Q92GI2|HLYC_RICCN Hemolysin C homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tlyC PE=3 SV=1 228 387 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 114 133 19
3 138 160 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5334
MRTPRSASSQGLISLRPAIVGLARLVATGLSTVNAAPLDHYIPTAHHGQAKTPVWVLAVASMALVLLGGAFAGLT
IALMGQDSIYLQVVSGDPSEPQSKNAKRVLNLLNRGKHWVLVTLLLANVIVNESLPVVLDRTLGGGVAAVVGSTI
LIVIFGEIVPQSICVRYGLPIGGYMSRPVLALMYLLSPVAWPTAKLLDWVLGEDHGTVYKKSGLKTLVTLHKSLG
ELSERLNQDEVTIITAVLDLKDKPVSEVMTPMDDVFTLAEDHVLDEKTMDTILSSGYSRIPIYRAKNPSDFVGML
LVKTLITYDPEDRIPVRDVQLGAIVETRPETSCLDIINFFQEGKSHMVLVSDAPGSDHGALGVVTLEDVIEELIG
EEIVDESDVYVDVHKAIRRLTPAPRARRLQHEVATAATAAAAAAKKPLSEGPLLVDIAEDDEGQGFAVGSVGAHS
EGVLETPSVVASMQQQQQQASQQQNQHQQQQQQLHTKTAIFMKRRSSAGPDGTAESGTVPVKASLDEMKPQLRLG
PANRAAHPRTTIRNNVFKIKQGLGGGVVTTFVGKNENGHLAEDHSHHNHHNHSYDSGNDAHHGLAGAQGPPEISL
SPAVDNGGETTPLLSKQPQKPMANGNGKANGNGKGYGSPRGRNKSRDNDWK*
Coding >OphauB2|5334
ATGAGGACGCCTCGTTCTGCTTCGTCTCAGGGCCTCATCAGCCTGCGGCCTGCCATTGTCGGCCTCGCTCGACTT
GTCGCCACGGGCCTGTCCACCGTCAATGCCGCCCCGCTAGACCACTATATTCCCACTGCCCACCATGGCCAGGCC
AAGACGCCCGTTTGGGTCCTTGCCGTTGCCTCCATGGCCCTTGTGCTGCTGGGCGGCGCCTTTGCCGGGTTGACT
ATTGCCTTGATGGGTCAAGACAGCATCTATCTTCAGGTGGTGTCTGGTGATCCCTCGGAACCGCAGTCCAAGAAT
GCAAAGAGAGTGCTCAATCTGCTCAACAGGGGCAAGCATTGGGTCCTTGTTACACTTTTGCTCGCAAACGTCATT
GTCAATGAGTCGCTGCCCGTTGTGCTCGACCGGACCCTTGGTGGCGGTGTTGCTGCTGTTGTTGGCAGCACCATT
TTGATCGTAATATTTGGCGAAATTGTCCCCCAGTCGATTTGCGTGCGCTACGGCCTCCCCATTGGCGGCTACATG
TCGCGTCCGGTCCTGGCACTCATGTATCTGCTGAGCCCGGTTGCTTGGCCGACTGCAAAACTGCTGGACTGGGTC
TTGGGCGAGGACCACGGCACAGTCTACAAGAAGAGCGGCCTCAAGACGCTCGTGACACTCCACAAGTCGCTGGGG
GAGCTGTCGGAGCGTCTCAACCAAGACGAGGTGACGATTATCACTGCAGTCTTGGACCTCAAGGACAAGCCCGTG
TCCGAAGTCATGACTCCCATGGACGATGTCTTTACTCTGGCCGAGGACCATGTCCTTGACGAAAAGACGATGGAC
ACGATTCTCTCGTCGGGCTATTCTCGAATTCCCATTTACCGAGCCAAGAATCCAAGCGACTTTGTTGGCATGCTG
CTCGTCAAGACACTCATTACCTATGATCCCGAAGACCGCATTCCCGTGCGAGACGTGCAGCTGGGCGCCATTGTA
GAGACTCGCCCTGAAACGAGCTGCCTTGACATTATCAACTTTTTCCAAGAGGGCAAATCGCACATGGTGCTTGTG
TCGGACGCGCCCGGCTCCGACCACGGGGCTCTGGGCGTTGTGACGCTTGAGGATGTAATTGAAGAGCTTATTGGA
GAAGAAATTGTGGACGAATCGGATGTCTATGTTGACGTGCACAAGGCGATTCGACGCTTGACGCCGGCCCCGCGC
GCCCGGCGCCTGCAGCATGAAGTGGCAACGGCGGCAACGGCTGCAGCTGCGGCAGCAAAGAAGCCCCTCAGTGAG
GGCCCTCTTTTGGTGGACATTGCAGAGGATGACGAGGGGCAGGGCTTTGCCGTGGGCTCTGTTGGGGCGCACAGC
GAGGGTGTTTTGGAGACGCCGTCTGTAGTGGCATCGATGCAGCAGCAGCAGCAACAGGCGTCACAGCAACAGAAT
CAGCACCAGCAACAGCAACAGCAGCTTCACACCAAGACGGCCATTTTTATGAAGCGGCGCAGCTCGGCTGGCCCG
GATGGCACGGCCGAGAGCGGCACGGTGCCTGTCAAGGCGTCGCTTGATGAAATGAAGCCGCAGCTGCGCCTGGGA
CCGGCGAATCGGGCTGCTCACCCACGCACCACAATACGCAACAATGTGTTCAAGATTAAGCAAGGCCTCGGCGGC
GGCGTGGTTACAACGTTTGTCGGCAAGAATGAAAATGGACACTTGGCAGAGGACCACAGCCACCACAACCATCAC
AACCACAGCTATGACTCTGGTAATGATGCTCACCATGGGCTGGCTGGTGCACAGGGACCGCCTGAAATTAGCCTG
TCGCCCGCCGTTGACAATGGAGGCGAGACGACGCCACTCTTGTCGAAGCAGCCGCAGAAGCCCATGGCCAATGGC
AATGGCAAAGCCAATGGCAATGGCAAGGGGTATGGAAGCCCACGAGGCCGAAACAAGAGCCGCGACAATGACTGG
AAATGA
Transcript >OphauB2|5334
ATGAGGACGCCTCGTTCTGCTTCGTCTCAGGGCCTCATCAGCCTGCGGCCTGCCATTGTCGGCCTCGCTCGACTT
GTCGCCACGGGCCTGTCCACCGTCAATGCCGCCCCGCTAGACCACTATATTCCCACTGCCCACCATGGCCAGGCC
AAGACGCCCGTTTGGGTCCTTGCCGTTGCCTCCATGGCCCTTGTGCTGCTGGGCGGCGCCTTTGCCGGGTTGACT
ATTGCCTTGATGGGTCAAGACAGCATCTATCTTCAGGTGGTGTCTGGTGATCCCTCGGAACCGCAGTCCAAGAAT
GCAAAGAGAGTGCTCAATCTGCTCAACAGGGGCAAGCATTGGGTCCTTGTTACACTTTTGCTCGCAAACGTCATT
GTCAATGAGTCGCTGCCCGTTGTGCTCGACCGGACCCTTGGTGGCGGTGTTGCTGCTGTTGTTGGCAGCACCATT
TTGATCGTAATATTTGGCGAAATTGTCCCCCAGTCGATTTGCGTGCGCTACGGCCTCCCCATTGGCGGCTACATG
TCGCGTCCGGTCCTGGCACTCATGTATCTGCTGAGCCCGGTTGCTTGGCCGACTGCAAAACTGCTGGACTGGGTC
TTGGGCGAGGACCACGGCACAGTCTACAAGAAGAGCGGCCTCAAGACGCTCGTGACACTCCACAAGTCGCTGGGG
GAGCTGTCGGAGCGTCTCAACCAAGACGAGGTGACGATTATCACTGCAGTCTTGGACCTCAAGGACAAGCCCGTG
TCCGAAGTCATGACTCCCATGGACGATGTCTTTACTCTGGCCGAGGACCATGTCCTTGACGAAAAGACGATGGAC
ACGATTCTCTCGTCGGGCTATTCTCGAATTCCCATTTACCGAGCCAAGAATCCAAGCGACTTTGTTGGCATGCTG
CTCGTCAAGACACTCATTACCTATGATCCCGAAGACCGCATTCCCGTGCGAGACGTGCAGCTGGGCGCCATTGTA
GAGACTCGCCCTGAAACGAGCTGCCTTGACATTATCAACTTTTTCCAAGAGGGCAAATCGCACATGGTGCTTGTG
TCGGACGCGCCCGGCTCCGACCACGGGGCTCTGGGCGTTGTGACGCTTGAGGATGTAATTGAAGAGCTTATTGGA
GAAGAAATTGTGGACGAATCGGATGTCTATGTTGACGTGCACAAGGCGATTCGACGCTTGACGCCGGCCCCGCGC
GCCCGGCGCCTGCAGCATGAAGTGGCAACGGCGGCAACGGCTGCAGCTGCGGCAGCAAAGAAGCCCCTCAGTGAG
GGCCCTCTTTTGGTGGACATTGCAGAGGATGACGAGGGGCAGGGCTTTGCCGTGGGCTCTGTTGGGGCGCACAGC
GAGGGTGTTTTGGAGACGCCGTCTGTAGTGGCATCGATGCAGCAGCAGCAGCAACAGGCGTCACAGCAACAGAAT
CAGCACCAGCAACAGCAACAGCAGCTTCACACCAAGACGGCCATTTTTATGAAGCGGCGCAGCTCGGCTGGCCCG
GATGGCACGGCCGAGAGCGGCACGGTGCCTGTCAAGGCGTCGCTTGATGAAATGAAGCCGCAGCTGCGCCTGGGA
CCGGCGAATCGGGCTGCTCACCCACGCACCACAATACGCAACAATGTGTTCAAGATTAAGCAAGGCCTCGGCGGC
GGCGTGGTTACAACGTTTGTCGGCAAGAATGAAAATGGACACTTGGCAGAGGACCACAGCCACCACAACCATCAC
AACCACAGCTATGACTCTGGTAATGATGCTCACCATGGGCTGGCTGGTGCACAGGGACCGCCTGAAATTAGCCTG
TCGCCCGCCGTTGACAATGGAGGCGAGACGACGCCACTCTTGTCGAAGCAGCCGCAGAAGCCCATGGCCAATGGC
AATGGCAAAGCCAATGGCAATGGCAAGGGGTATGGAAGCCCACGAGGCCGAAACAAGAGCCGCGACAATGACTGG
AAATGA
Gene >OphauB2|5334
ATGAGGACGCCTCGTTCTGCTTCGTCTCAGGGCCTCATCAGCCTGCGGCCTGCCATTGTCGGCCTCGCTCGACTT
GTCGCCACGGGCCTGTCCACCGTCAATGCCGCCCCGCTAGACCACTATATTCCCACTGCCCACCATGGCCAGGCC
AAGACGCCCGTTTGGGTCCTTGCCGTTGCCTCCATGGCCCTTGTGCTGCTGGGCGGCGCCTTTGCCGGGTTGACT
ATTGCGTCTGTTTGACCCAAGTATGCACCCCGTCGTTTGTAATGGCTGCTAACCGCCTTTTTTCTTGTGCAGCTT
GATGGGTCAAGACAGCATCTATCTTCAGGTGGTGTCTGGTGATCCCTCGGAACCGCAGTCCAAGAATGCAAAGAG
AGTGCTCAATCTGCTCAACAGGGGCAAGCATTGGGTCCTTGTTACACTTTTGCTCGCAAACGTCATTGTCAATGA
GTCGCTGCCCGTTGTGCTCGACCGGACCCTTGGTGGCGGTGTTGCTGCTGTTGTTGGCAGCACCATTTTGATCGG
TAGGCCCTGCCAAAAAAATTTATACCTCGTGATGGAAACTAACGCCCTTGGTGCACCAGTAATATTTGGCGAAAT
TGTCCCCCAGTCGATTTGCGTGCGCTACGGCCTCCCCATTGGCGGCTACATGTCGCGTCCGGTCCTGGCACTCAT
GTATCTGCTGAGCCCGGTTGCTTGGCCGACTGCAAAACTGCTGGACTGGGTCTTGGGCGAGGACCACGGCACAGT
CTACAAGAAGAGCGGCCTCAAGACGCTCGTGACACTCCACAAGTCGCTGGGGGAGCTGTCGGAGCGTCTCAACCA
AGACGAGGTGACGATTATCACTGCAGTCTTGGACCTCAAGGACAAGCCCGTGTCCGAAGTCATGACTCCCATGGA
CGATGTCTTTACTCTGGCCGAGGACCATGTCCTTGACGAAAAGACGATGGACACGATTCTCTCGTCGGGCTATTC
TCGAATTCCCATTTACCGAGCCAAGAATCCAAGCGACTTTGTTGGCATGCTGCTCGTCAAGACACTCATTACCTA
TGATCCCGAAGACCGCATTCCCGTGCGAGACGTGCAGCTGGGCGCCATTGTAGAGACTCGCCCTGAAACGAGCTG
CCTTGACATTATCAACTTTTTCCAAGAGGGCAAATCGCACATGGTGCTTGTGTCGGACGCGCCCGGCTCCGACCA
CGGGGCTCTGGGCGTTGTGACGCTTGAGGATGTAATTGAAGAGCTTATTGGAGAGTAGGTTTTGGCCCACATGAG
CCGCATACGTTTTGAGGGGCCGGTTACTGACTGCAGCAGAGAAATTGTGGACGAATCGGATGTCTATGTTGACGT
GCACAAGGCGATTCGACGCTTGACGCCGGCCCCGCGCGCCCGGCGCCTGCAGCATGAAGTGGCAACGGCGGCAAC
GGCTGCAGCTGCGGCAGCAAAGAAGCCCCTCAGTGAGGGCCCTCTTTTGGTGGACATTGCAGAGGATGACGAGGG
GCAGGGCTTTGCCGTGGGCTCTGTTGGGGCGCACAGCGAGGGTGTTTTGGAGACGCCGTCTGTAGTGGCATCGAT
GCAGCAGCAGCAGCAACAGGCGTCACAGCAACAGAATCAGCACCAGCAACAGCAACAGCAGCTTCACACCAAGAC
GGCCATTTTTATGAAGCGGCGCAGCTCGGCTGGCCCGGATGGCACGGCCGAGAGCGGCACGGTGCCTGTCAAGGC
GTCGCTTGATGAAATGAAGCCGCAGCTGCGCCTGGGACCGGCGAATCGGGCTGCTCACCCACGCACCACAATACG
CAACAATGTGTTCAAGATTAAGCAAGGCCTCGGCGGCGGCGTGGTTACAACGTTTGTCGGCAAGAATGAAAATGG
ACACTTGGCAGAGGACCACAGCCACCACAACCATCACAACCACAGCTATGACTCTGGTAATGATGCTCACCATGG
GCTGGCTGGTGCACAGGGACCGCCTGAAATTAGCCTGTCGCCCGCCGTTGACAATGGAGGCGAGACGACGCCACT
CTTGTCGAAGCAGCCGCAGAAGCCCATGGCCAATGGCAATGGCAAAGCCAATGGCAATGGCAAGGGGTATGGAAG
CCCACGAGGCCGAAACAAGAGCCGCGACAATGACTGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail