Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5325
Gene name
LocationContig_4:337561..339052
Strand-
Gene length (bp)1491
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06398 Pex24p Integral peroxisomal membrane peroxin 5.5E-86 87 467

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03370|PEX29_YEAST Peroxisomal membrane protein PEX29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX29 PE=1 SV=1 15 479 2.0E-54
sp|P38848|PEX28_YEAST Peroxisomal membrane protein PEX28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX28 PE=1 SV=1 56 415 2.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 245 267 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5325
MLQPMLQPMDDFTAEAVARGHDAPRRDSSISASSSASKGGLRSSLAAIREKPTLQDRLVERLLQQVIPVDGHHGA
SADTSPSLPQRPNFNLTTMSHNFRHFNARIGVVFDFQRDVERLFSWCHPSHTLSFLAIYSLVCLDPYLLPALPMV
LLVFAVLVPAFIARHPAPPRGTLSSEQSVGYSPRGPPLAPATTVRPAKEFSSDFFRNSRDLQNSMGDFTHAYDKI
VELLVPVTNFSNEALSSTVFLFLFAGALGLTLIAHIIPWRIIFLLGGWALILLAHPSVKAVLRAKHQQHVQPHEG
EALSWLDRWIAQDVILDSAPETREVEIFELQHHDSDSGEWEPWLFSPSPYDPLSPPRIAGDRPRGSRFFEDVMPP
AGWQWSEKKWALDLWSREWVEERIITGVEVETEGERWVYDMYTQHDDRTGVVEYLAKEPTAFRPRASPQPSWEES
DDEGGKRGAWRRRRWVRLVKRKVATAEVS*
Coding >OphauB2|5325
ATGCTCCAGCCCATGCTCCAGCCCATGGACGACTTTACTGCTGAAGCCGTTGCCCGAGGGCACGACGCGCCCAGA
CGCGACTCTTCAATTTCTGCGTCCTCTTCCGCTTCAAAGGGCGGCTTGCGCAGCAGCCTGGCAGCCATTCGCGAA
AAGCCGACGCTTCAAGATCGCCTGGTTGAAAGACTTCTTCAACAAGTAATTCCCGTCGATGGCCACCATGGCGCC
TCTGCCGATACCTCGCCCTCCTTGCCCCAGCGGCCCAATTTCAACCTGACGACCATGTCGCACAACTTTCGCCAC
TTCAACGCCCGAATCGGCGTTGTCTTTGACTTTCAGCGCGATGTCGAGCGTCTCTTCTCGTGGTGCCATCCCTCG
CACACCCTCTCCTTCCTCGCCATTTACTCCCTCGTCTGTCTCGACCCCTATCTTTTGCCCGCCTTGCCCATGGTT
CTCCTCGTCTTCGCCGTCCTCGTCCCGGCCTTTATCGCCCGACATCCCGCCCCTCCGCGCGGCACCTTGTCAAGC
GAGCAGTCTGTCGGCTACTCTCCTCGTGGTCCTCCGCTGGCTCCCGCTACTACGGTGCGCCCCGCAAAAGAATTC
AGCAGCGACTTCTTCCGCAACTCACGCGACCTGCAAAATAGCATGGGCGACTTTACCCATGCCTATGACAAGATT
GTTGAGCTGCTCGTGCCCGTCACAAACTTTAGCAACGAGGCCTTGTCCTCTACAGTCTTTTTGTTCCTCTTTGCC
GGCGCTCTCGGCCTCACTCTTATTGCGCACATCATTCCTTGGCGCATCATTTTCCTCCTTGGCGGCTGGGCTCTA
ATTTTGCTAGCGCACCCATCAGTCAAGGCGGTGCTTCGAGCAAAACATCAGCAGCACGTACAACCTCATGAAGGA
GAGGCCCTCTCGTGGCTCGACCGCTGGATCGCCCAAGACGTCATTCTCGACTCGGCCCCCGAGACGCGCGAGGTG
GAAATCTTTGAACTCCAGCACCACGACTCAGACTCGGGCGAGTGGGAGCCCTGGCTCTTTTCGCCCTCTCCCTAC
GACCCCTTGTCGCCCCCGCGCATTGCCGGCGACAGGCCGCGCGGCTCCCGCTTCTTTGAGGATGTGATGCCCCCG
GCCGGTTGGCAGTGGAGCGAAAAGAAGTGGGCTCTTGACCTCTGGAGCCGTGAATGGGTCGAGGAGCGCATCATT
ACAGGCGTCGAGGTGGAAACCGAAGGCGAGCGCTGGGTCTACGACATGTACACTCAGCATGACGATCGCACTGGC
GTTGTCGAATACCTTGCCAAGGAGCCGACGGCCTTTCGCCCTAGAGCCTCGCCTCAGCCAAGTTGGGAAGAGAGC
GACGACGAGGGCGGCAAGCGGGGCGCGTGGCGACGCAGGCGATGGGTTCGCTTGGTCAAAAGAAAGGTTGCCACT
GCAGAGGTTAGCTGA
Transcript >OphauB2|5325
ATGCTCCAGCCCATGCTCCAGCCCATGGACGACTTTACTGCTGAAGCCGTTGCCCGAGGGCACGACGCGCCCAGA
CGCGACTCTTCAATTTCTGCGTCCTCTTCCGCTTCAAAGGGCGGCTTGCGCAGCAGCCTGGCAGCCATTCGCGAA
AAGCCGACGCTTCAAGATCGCCTGGTTGAAAGACTTCTTCAACAAGTAATTCCCGTCGATGGCCACCATGGCGCC
TCTGCCGATACCTCGCCCTCCTTGCCCCAGCGGCCCAATTTCAACCTGACGACCATGTCGCACAACTTTCGCCAC
TTCAACGCCCGAATCGGCGTTGTCTTTGACTTTCAGCGCGATGTCGAGCGTCTCTTCTCGTGGTGCCATCCCTCG
CACACCCTCTCCTTCCTCGCCATTTACTCCCTCGTCTGTCTCGACCCCTATCTTTTGCCCGCCTTGCCCATGGTT
CTCCTCGTCTTCGCCGTCCTCGTCCCGGCCTTTATCGCCCGACATCCCGCCCCTCCGCGCGGCACCTTGTCAAGC
GAGCAGTCTGTCGGCTACTCTCCTCGTGGTCCTCCGCTGGCTCCCGCTACTACGGTGCGCCCCGCAAAAGAATTC
AGCAGCGACTTCTTCCGCAACTCACGCGACCTGCAAAATAGCATGGGCGACTTTACCCATGCCTATGACAAGATT
GTTGAGCTGCTCGTGCCCGTCACAAACTTTAGCAACGAGGCCTTGTCCTCTACAGTCTTTTTGTTCCTCTTTGCC
GGCGCTCTCGGCCTCACTCTTATTGCGCACATCATTCCTTGGCGCATCATTTTCCTCCTTGGCGGCTGGGCTCTA
ATTTTGCTAGCGCACCCATCAGTCAAGGCGGTGCTTCGAGCAAAACATCAGCAGCACGTACAACCTCATGAAGGA
GAGGCCCTCTCGTGGCTCGACCGCTGGATCGCCCAAGACGTCATTCTCGACTCGGCCCCCGAGACGCGCGAGGTG
GAAATCTTTGAACTCCAGCACCACGACTCAGACTCGGGCGAGTGGGAGCCCTGGCTCTTTTCGCCCTCTCCCTAC
GACCCCTTGTCGCCCCCGCGCATTGCCGGCGACAGGCCGCGCGGCTCCCGCTTCTTTGAGGATGTGATGCCCCCG
GCCGGTTGGCAGTGGAGCGAAAAGAAGTGGGCTCTTGACCTCTGGAGCCGTGAATGGGTCGAGGAGCGCATCATT
ACAGGCGTCGAGGTGGAAACCGAAGGCGAGCGCTGGGTCTACGACATGTACACTCAGCATGACGATCGCACTGGC
GTTGTCGAATACCTTGCCAAGGAGCCGACGGCCTTTCGCCCTAGAGCCTCGCCTCAGCCAAGTTGGGAAGAGAGC
GACGACGAGGGCGGCAAGCGGGGCGCGTGGCGACGCAGGCGATGGGTTCGCTTGGTCAAAAGAAAGGTTGCCACT
GCAGAGGTTAGCTGA
Gene >OphauB2|5325
ATGCTCCAGCCCATGCTCCAGCCCATGGACGACTTTACTGCTGAAGCCGTTGCCCGAGGGCACGACGCGCCCAGA
CGCGACTCTTCAATTTCTGCGTCCTCTTCCGCTTCAAAGGGCGGCTTGCGCAGCAGCCTGGCAGCCATTCGCGAA
AAGCCGACGCTTCAAGATCGCCTGGTTGAAAGGCGAGATCTATTGCTTCCTCATGTGCTGCTTTTGCTAACCGCT
CTCAACAGACTTCTTCAACAAGTAATTCCCGTCGATGGCCACCATGGCGCCTCTGCCGATACCTCGCCCTCCTTG
CCCCAGCGGCCCAATTTCAACCTGACGACCATGTCGCACAACTTTCGCCACTTCAACGCCCGAATCGGCGTTGTC
TTTGACTTTCAGCGCGATGTCGAGCGTCTCTTCTCGTGGTGCCATCCCTCGCACACCCTCTCCTTCCTCGCCATT
TACTCCCTCGTCTGTCTCGACCCCTATCTTTTGCCCGCCTTGCCCATGGTTCTCCTCGTCTTCGCCGTCCTCGTC
CCGGCCTTTATCGCCCGACATCCCGCCCCTCCGCGCGGCACCTTGTCAAGCGAGCAGTCTGTCGGCTACTCTCCT
CGTGGTCCTCCGCTGGCTCCCGCTACTACGGTGCGCCCCGCAAAAGAATTCAGCAGCGACTTCTTCCGCAACTCA
CGCGACCTGCAAAATAGCATGGGCGACTTTACCCATGCCTATGACAAGATTGTTGAGCTGCTCGTGCCCGTCACA
AACTTTAGCAACGAGGCCTTGTCCTCTACAGTCTTTTTGTTCCTCTTTGCCGGCGCTCTCGGCCTCACTCTTATT
GCGCACATCATTCCTTGGCGCATCATTTTCCTCCTTGGCGGCTGGGCTCTAATTTTGCTAGCGCACCCATCAGTC
AAGGCGGTGCTTCGAGCAAAACATCAGCAGCACGTACAACCTCATGAAGGAGAGGCCCTCTCGTGGCTCGACCGC
TGGATCGCCCAAGACGTCATTCTCGACTCGGCCCCCGAGACGCGCGAGGTGGAAATCTTTGAACTCCAGCACCAC
GACTCAGACTCGGGCGAGTGGGAGCCCTGGCTCTTTTCGCCCTCTCCCTACGACCCCTTGTCGCCCCCGCGCATT
GCCGGCGACAGGCCGCGCGGCTCCCGCTTCTTTGAGGATGTGATGCCCCCGGCCGGTTGGCAGTGGAGCGAAAAG
AAGTGGGCTCTTGACCTCTGGAGCCGTGAATGGGTCGAGGAGCGCATCATTACAGGCGTCGAGGTGGAAACCGAA
GGCGAGCGCTGGGTCTACGACATGTACACTCAGCATGACGATCGCACTGGCGTTGTCGAATACCTTGCCAAGGAG
CCGACGGCCTTTCGCCCTAGAGCCTCGCCTCAGCCAAGTTGGGAAGAGAGCGACGACGAGGGCGGCAAGCGGGGC
GCGTGGCGACGCAGGCGATGGGTTCGCTTGGTCAAAAGAAAGGTTGCCACTGCAGAGGTTAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail