Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5317
Gene name
LocationContig_4:321916..322829
Strand-
Gene length (bp)913
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08193 INO80_Ies4 INO80 complex subunit Ies4 2.7E-75 5 240

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S9|IES4_SCHPO INO80 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ies4 PE=1 SV=1 158 207 3.0E-11

GO

GO Term Description Terminal node
GO:0006338 chromatin remodeling Yes
GO:0031011 Ino80 complex Yes
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:1904949 ATPase complex No
GO:0009987 cellular process No
GO:0070603 SWI/SNF superfamily-type complex No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0140513 nuclear protein-containing complex No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No
GO:0006325 chromatin organization No
GO:0097346 INO80-type complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5317
MPPSSKITEGRRKSAGKPTLLITLSLAPPKLRSLLLPQSTDEESPVKESASSKDDSKASPANSATPAPQSNSNSG
ENASDSNAATPAAEGTPVSSAMGPPADGPKKKGIKRSAATANGTGEGGSKPPRGKPGPKKKPRLEDGTIDHSTNR
PAGGHKLGPKANQGAINAGLRALDRSGKPCRKWSRGGFCLKSFTGVQWEIPRWKAPPKKSLEPNMNDSAVPSAEN
SSSKENKENRPDANSASNSNSGADMEMRSVLSVNASSPAPMAVGPAPITA*
Coding >OphauB2|5317
ATGCCTCCCTCTTCCAAGATTACCGAGGGCCGACGCAAGTCTGCTGGCAAACCCACCTTGCTCATCACCCTCTCC
CTCGCGCCCCCCAAGCTGCGCAGCCTCTTGCTGCCCCAGTCCACCGACGAGGAGTCGCCTGTCAAGGAGTCGGCT
TCCTCCAAGGATGACTCCAAGGCCTCGCCCGCCAACTCGGCCACCCCTGCACCACAGAGCAACTCCAACAGCGGC
GAGAATGCCTCTGATTCAAATGCAGCAACTCCTGCCGCAGAGGGCACCCCCGTTTCATCTGCCATGGGCCCTCCT
GCTGACGGTCCCAAGAAGAAGGGCATCAAGCGCTCTGCTGCTACTGCAAACGGCACCGGAGAAGGCGGCTCCAAA
CCACCCAGAGGAAAGCCGGGCCCTAAGAAGAAGCCTCGACTGGAGGACGGCACTATAGACCATTCTACTAACAGG
CCTGCTGGCGGTCACAAGCTCGGGCCCAAGGCCAATCAAGGGGCCATCAACGCTGGTCTACGCGCCCTCGACAGA
TCTGGGAAGCCCTGTCGCAAGTGGTCACGCGGAGGCTTTTGTCTCAAGAGCTTTACTGGCGTGCAGTGGGAGATT
CCCCGCTGGAAAGCACCGCCCAAGAAATCACTTGAACCCAACATGAATGACTCGGCTGTTCCGTCGGCCGAAAAC
AGCAGCAGCAAGGAGAACAAAGAAAACAGGCCCGACGCCAATAGCGCCAGCAACAGCAACAGTGGCGCCGACATG
GAAATGAGAAGCGTTCTTAGTGTCAACGCCTCGTCACCTGCCCCCATGGCCGTCGGGCCGGCCCCCATTACAGCA
TAA
Transcript >OphauB2|5317
ATGCCTCCCTCTTCCAAGATTACCGAGGGCCGACGCAAGTCTGCTGGCAAACCCACCTTGCTCATCACCCTCTCC
CTCGCGCCCCCCAAGCTGCGCAGCCTCTTGCTGCCCCAGTCCACCGACGAGGAGTCGCCTGTCAAGGAGTCGGCT
TCCTCCAAGGATGACTCCAAGGCCTCGCCCGCCAACTCGGCCACCCCTGCACCACAGAGCAACTCCAACAGCGGC
GAGAATGCCTCTGATTCAAATGCAGCAACTCCTGCCGCAGAGGGCACCCCCGTTTCATCTGCCATGGGCCCTCCT
GCTGACGGTCCCAAGAAGAAGGGCATCAAGCGCTCTGCTGCTACTGCAAACGGCACCGGAGAAGGCGGCTCCAAA
CCACCCAGAGGAAAGCCGGGCCCTAAGAAGAAGCCTCGACTGGAGGACGGCACTATAGACCATTCTACTAACAGG
CCTGCTGGCGGTCACAAGCTCGGGCCCAAGGCCAATCAAGGGGCCATCAACGCTGGTCTACGCGCCCTCGACAGA
TCTGGGAAGCCCTGTCGCAAGTGGTCACGCGGAGGCTTTTGTCTCAAGAGCTTTACTGGCGTGCAGTGGGAGATT
CCCCGCTGGAAAGCACCGCCCAAGAAATCACTTGAACCCAACATGAATGACTCGGCTGTTCCGTCGGCCGAAAAC
AGCAGCAGCAAGGAGAACAAAGAAAACAGGCCCGACGCCAATAGCGCCAGCAACAGCAACAGTGGCGCCGACATG
GAAATGAGAAGCGTTCTTAGTGTCAACGCCTCGTCACCTGCCCCCATGGCCGTCGGGCCGGCCCCCATTACAGCA
TAA
Gene >OphauB2|5317
ATGCCTCCCTCTTCCAAGATTACCGAGGGCCGACGCAAGTCTGCTGGCAAACCCACCTTGCTCATCACCCTCTCC
CTCGCGCCCCCCAAGCTGCGCAGCCTCTTGCTGCCCCAGTCCACCGACGAGGAGTCGCCTGTCAAGGAGTCGGCT
TCCTCCAAGGATGACTCCAAGGCCTCGCCCGCCAACTCGGCCACCCCTGCACCACAGAGCAACTCCAACAGCGGC
GAGAATGCCTCTGATTCAAATGCAGCAACTCCTGCCGCAGAGGGCACCCCCGTTTCATCTGCCATGGGCCCTCCT
GCTGACGGTCCCAAGAAGAAGGGCATCAAGCGCTCTGCTGCTACTGCAAACGGCACCGGAGAAGGCGGCTCCAAA
CCACCCAGAGGAAAGCCGGGCCCTAAGAAGAAGCCTCGACTGTATGTCGTTTGTTCTCGTCGTGGTGCTATTATG
CATCGCGTCATTCCGCCTCGGAAAGCATGCACGTACTGACTTGCAGAACAGGGAGGACGGCACTATAGACCATTC
TACTAACAGGCCTGCTGGCGGTCACAAGCTCGGGCCCAAGGCCAATCAAGGGGCCATCAACGCTGGTCTACGCGC
CCTCGACAGATCTGGGAAGCCCTGTCGCAAGTGGTCACGCGGAGGCTTTTGTCTCAAGAGCTTTACTGGCGTGCA
GTGGGAGATTCCCCGCTGGAAAGCACCGCCCAAGAAATCACTTGAACCCAACATGAATGACTCGGCTGTTCCGTC
GGCCGAAAACAGCAGCAGCAAGGAGAACAAAGAAAACAGGCCCGACGCCAATAGCGCCAGCAACAGCAACAGTGG
CGCCGACATGGAAATGAGAAGCGTTCTTAGTGTCAACGCCTCGTCACCTGCCCCCATGGCCGTCGGGCCGGCCCC
CATTACAGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail