Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5314
Gene name
LocationContig_4:316590..317491
Strand+
Gene length (bp)901
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 5.0E-16 59 156
PF17171 GST_C_6 Glutathione S-transferase, C-terminal domain 1.3E-12 206 269
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 1.6E-06 61 157

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HE00|MTX1_SCHPO Metaxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtx1 PE=3 SV=1 17 242 3.0E-14

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0032991 protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:0005742 mitochondrial outer membrane translocase complex No
GO:0098798 mitochondrial protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5314
MATSPNWFPEAPSPIRSVFRRFPLRLFSPEALPSEARCDRPQLFLYTNRSDSDRPGFTPSCLKWQLWLRICGIRV
EIRSSNAHASPGRSLPFVVPAMSDSQSPNPIPSSLIAAYARNHSSYNEPQIPSLRFETYLSLFESSIQPAWLYTL
YLVPENACLVAVLFMPRSHIIHPHLLRQLRLDAHQSIISLSRHYRYSAQLLLNNATQAFLALDKLLGSSAYFFDA
PSPTIFDATVFSYTHLILPNSSIHWPQNPLRPSLDKCHNLQRHRRLLYSRYFPVKL*
Coding >OphauB2|5314
ATGGCCACCTCGCCAAACTGGTTCCCCGAGGCGCCCTCGCCCATCCGTTCCGTCTTTCGTCGCTTTCCTCTCCGC
TTATTTAGCCCCGAAGCTCTTCCCAGCGAAGCCCGTTGTGACCGGCCCCAGCTCTTCCTTTATACTAATCGCAGC
GACTCTGACCGCCCCGGCTTCACCCCAAGCTGCCTCAAGTGGCAGCTCTGGCTACGCATTTGCGGCATCCGTGTC
GAAATCCGCTCCTCCAATGCCCACGCCTCGCCAGGCCGCTCTCTGCCCTTTGTCGTTCCCGCCATGAGCGACTCT
CAGTCCCCCAACCCTATTCCCTCTTCCCTCATTGCTGCCTATGCTCGCAACCACTCTTCTTACAATGAACCCCAA
ATCCCCTCCCTTCGCTTCGAGACCTACCTCTCCCTCTTTGAATCCTCCATTCAGCCCGCATGGCTCTATACTCTC
TACCTCGTCCCCGAGAATGCCTGCCTCGTTGCTGTTCTCTTCATGCCGAGATCTCATATAATACACCCGCACTTG
CTCCGCCAACTTCGTCTCGACGCCCACCAGTCCATCATCTCCCTCTCCCGCCACTACAGGTACAGCGCCCAGCTT
CTCCTCAACAATGCAACTCAAGCTTTCCTGGCTCTCGACAAGCTTCTCGGCTCCAGTGCCTACTTCTTTGATGCC
CCCTCACCAACAATATTCGACGCCACCGTCTTCTCCTACACACACCTCATTCTTCCAAACAGCTCCATCCACTGG
CCACAAAATCCTCTTCGCCCCTCTCTCGACAAATGCCACAACTTGCAACGTCACCGCAGACTTCTTTATTCTCGC
TACTTTCCGGTAAAGCTTTAA
Transcript >OphauB2|5314
ATGGCCACCTCGCCAAACTGGTTCCCCGAGGCGCCCTCGCCCATCCGTTCCGTCTTTCGTCGCTTTCCTCTCCGC
TTATTTAGCCCCGAAGCTCTTCCCAGCGAAGCCCGTTGTGACCGGCCCCAGCTCTTCCTTTATACTAATCGCAGC
GACTCTGACCGCCCCGGCTTCACCCCAAGCTGCCTCAAGTGGCAGCTCTGGCTACGCATTTGCGGCATCCGTGTC
GAAATCCGCTCCTCCAATGCCCACGCCTCGCCAGGCCGCTCTCTGCCCTTTGTCGTTCCCGCCATGAGCGACTCT
CAGTCCCCCAACCCTATTCCCTCTTCCCTCATTGCTGCCTATGCTCGCAACCACTCTTCTTACAATGAACCCCAA
ATCCCCTCCCTTCGCTTCGAGACCTACCTCTCCCTCTTTGAATCCTCCATTCAGCCCGCATGGCTCTATACTCTC
TACCTCGTCCCCGAGAATGCCTGCCTCGTTGCTGTTCTCTTCATGCCGAGATCTCATATAATACACCCGCACTTG
CTCCGCCAACTTCGTCTCGACGCCCACCAGTCCATCATCTCCCTCTCCCGCCACTACAGGTACAGCGCCCAGCTT
CTCCTCAACAATGCAACTCAAGCTTTCCTGGCTCTCGACAAGCTTCTCGGCTCCAGTGCCTACTTCTTTGATGCC
CCCTCACCAACAATATTCGACGCCACCGTCTTCTCCTACACACACCTCATTCTTCCAAACAGCTCCATCCACTGG
CCACAAAATCCTCTTCGCCCCTCTCTCGACAAATGCCACAACTTGCAACGTCACCGCAGACTTCTTTATTCTCGC
TACTTTCCGGTAAAGCTTTAA
Gene >OphauB2|5314
ATGGCCACCTCGCCAAACTGGTTCCCCGAGGCGCCCTCGCCCATCCGTTCCGTCTTTCGTCGCTTTCCTCTCCGC
TTATTTAGCCCCGAAGCTCTTCCCAGCGAAGCCCGTTGTGACCGGCCCCAGCTCTTCCTTTATACTAATCGCAGC
GACTCTGACCGCCCCGGCTTCACCCCAAGCTGCCTCAAGTGGCAGCTCTGGCTACGCATTTGCGGCATCCGTGTC
GAAATCCGCTCCTCCAATGCCCACGCCTCGCCAGGCCGCTCTCTGCCCTTTGTCGTTCCCGCCATGAGCGACTCT
CAGTCCCCCAACCCTATTCCCTCTTCCCTCATTGCTGCCTATGCTCGCAACCACTCTTCTTACAATGAACCCCAA
ATCCCCTCCCTTCGCTTCGAGACCTACCTCTCCCTCTTTGAATCCTCCATTCAGCCCGCATGGGTCAGTTGCTTC
CATCCTTTGCTCTCTTTGCTCGCTAACAATGTCTCCATCTTAGCTCTATACTCTCTACCTCGTCCCCGAGAATGC
CTGCCTCGTTGCTGTTCTCTTCATGCCGAGATCTCATATAATACACCCGCACTTGCTCCGCCAACTTCGTCTCGA
CGCCCACCAGTCCATCATCTCCCTCTCCCGCCACTACAGGTACAGCGCCCAGCTTCTCCTCAACAATGCAACTCA
AGCTTTCCTGGCTCTCGACAAGCTTCTCGGCTCCAGTGCCTACTTCTTTGATGCCCCCTCACCAACAATATTCGA
CGCCACCGTCTTCTCCTACACACACCTCATTCTTCCAAACAGCTCCATCCACTGGCCACAAAATCCTCTTCGCCC
CTCTCTCGACAAATGCCACAACTTGCAACGTCACCGCAGACTTCTTTATTCTCGCTACTTTCCGGTAAAGCTTTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail