Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5311
Gene name
LocationContig_4:312219..313154
Strand-
Gene length (bp)935
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05724 TPMT Thiopurine S-methyltransferase (TPMT) 9.1E-27 27 225
PF13649 Methyltransf_25 Methyltransferase domain 3.9E-07 80 191
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-06 78 195
PF13489 Methyltransf_23 Methyltransferase domain 8.3E-07 80 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 5 261 8.0E-22
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 11 230 3.0E-18
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 22 230 4.0E-18
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 30 230 1.0E-17
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 11 230 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 5 261 8.0E-22
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 11 230 3.0E-18
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 22 230 4.0E-18
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 30 230 1.0E-17
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 11 230 2.0E-16
sp|A7MVH9|TPMT_VIBCB Thiopurine S-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tpm PE=3 SV=1 38 222 4.0E-07
sp|Q93JT2|TPMT_PSEU5 Thiopurine S-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=tpm PE=3 SV=3 28 202 1.0E-06
sp|A9I3K3|TPMT_BORPD Thiopurine S-methyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=tpm PE=3 SV=1 76 232 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5311
MADTHVAPASSPQLSSLFANTPLAEQASRWDALYQRSHTPWDRAGPSLALADVLTQRRDLVPPVDSPHDAPHRPT
ALVPGCGPGHDVLLLSSFGYDVWGLDISPGAFALAQQNRLEAERHGRYAPVHGVAQAGRIHWLTADFFDEAWSRG
IGTGGDGRFDLVFDYTFLCALPIAARPQWAKRMSSLVRPRGRLICLEFPSSKPLLEPGPPWPMRPEVYEALLAAP
GQDAVYDADGSIVCSVNAKPSHGALHRLGIIKPERTHPAGTAPDGSVIDFISIWAPS*
Coding >OphauB2|5311
ATGGCCGACACGCACGTCGCTCCCGCCTCGTCGCCCCAGCTGTCGTCCTTGTTTGCAAACACCCCCCTCGCAGAG
CAGGCCTCGCGCTGGGACGCCCTCTACCAACGCTCCCACACGCCCTGGGACCGCGCCGGGCCCTCGCTCGCCCTC
GCCGATGTCCTGACCCAGCGCCGAGACCTTGTCCCCCCGGTAGACTCGCCCCACGATGCACCTCACCGTCCCACC
GCCCTTGTGCCCGGATGTGGGCCCGGCCACGACGTCTTGCTGCTCAGCTCCTTTGGCTACGACGTCTGGGGGCTC
GATATTAGCCCGGGTGCTTTTGCTCTCGCCCAACAGAATCGCCTGGAGGCAGAGCGCCACGGCCGCTATGCGCCT
GTCCACGGCGTTGCCCAGGCCGGCCGCATTCACTGGCTGACGGCAGACTTTTTCGACGAGGCTTGGTCACGCGGC
ATTGGCACCGGCGGCGACGGCAGGTTTGATCTCGTATTTGACTATACGTTTCTCTGCGCCCTGCCCATTGCTGCT
CGTCCCCAGTGGGCCAAGCGCATGTCCAGCCTGGTGCGCCCTCGCGGCCGCCTCATCTGCCTCGAGTTTCCCTCC
AGCAAGCCTCTTCTTGAGCCAGGCCCGCCATGGCCCATGCGGCCCGAGGTATATGAGGCGCTGCTCGCTGCTCCG
GGCCAAGACGCTGTATACGATGCCGACGGGTCCATTGTCTGCTCCGTCAATGCCAAGCCCAGCCATGGCGCTCTG
CACCGCCTGGGCATCATCAAGCCTGAGCGCACTCATCCCGCGGGTACGGCGCCCGATGGCTCCGTCATTGACTTC
ATCTCCATCTGGGCGCCGTCATGA
Transcript >OphauB2|5311
ATGGCCGACACGCACGTCGCTCCCGCCTCGTCGCCCCAGCTGTCGTCCTTGTTTGCAAACACCCCCCTCGCAGAG
CAGGCCTCGCGCTGGGACGCCCTCTACCAACGCTCCCACACGCCCTGGGACCGCGCCGGGCCCTCGCTCGCCCTC
GCCGATGTCCTGACCCAGCGCCGAGACCTTGTCCCCCCGGTAGACTCGCCCCACGATGCACCTCACCGTCCCACC
GCCCTTGTGCCCGGATGTGGGCCCGGCCACGACGTCTTGCTGCTCAGCTCCTTTGGCTACGACGTCTGGGGGCTC
GATATTAGCCCGGGTGCTTTTGCTCTCGCCCAACAGAATCGCCTGGAGGCAGAGCGCCACGGCCGCTATGCGCCT
GTCCACGGCGTTGCCCAGGCCGGCCGCATTCACTGGCTGACGGCAGACTTTTTCGACGAGGCTTGGTCACGCGGC
ATTGGCACCGGCGGCGACGGCAGGTTTGATCTCGTATTTGACTATACGTTTCTCTGCGCCCTGCCCATTGCTGCT
CGTCCCCAGTGGGCCAAGCGCATGTCCAGCCTGGTGCGCCCTCGCGGCCGCCTCATCTGCCTCGAGTTTCCCTCC
AGCAAGCCTCTTCTTGAGCCAGGCCCGCCATGGCCCATGCGGCCCGAGGTATATGAGGCGCTGCTCGCTGCTCCG
GGCCAAGACGCTGTATACGATGCCGACGGGTCCATTGTCTGCTCCGTCAATGCCAAGCCCAGCCATGGCGCTCTG
CACCGCCTGGGCATCATCAAGCCTGAGCGCACTCATCCCGCGGGTACGGCGCCCGATGGCTCCGTCATTGACTTC
ATCTCCATCTGGGCGCCGTCATGA
Gene >OphauB2|5311
ATGGCCGACACGCACGTCGCTCCCGCCTCGTCGCCCCAGCTGTCGTCCTTGTTTGCAAACACCCCCCTCGCAGAG
CAGGCCTCGCGCTGGGACGCCCTCTACCAACGCTCCCACACGCCCTGGGACCGCGCCGGGCCCTCGCTCGCCCTC
GCCGATGTCCTGACCCAGCGCCGAGACCTTGTCCCCCCGGTAGACTCGCCCCACGATGCACCTCACCGTCCCACC
GCCCTTGTGCCCGGATGTGGGCCCGGCCACGACGTCTTGCTGCTCAGCTCCTTTGGCTACGACGTCTGGGGGCTC
GATATTAGCCCGGGTGCTTTTGCTCTCGCCCAACAGAATCGCCTGGAGGCAGAGCGCCACGGCCGCTATGCGCCT
GTCCACGGCGTTGCCCAGGCCGGCCGCATTCACTGGCTGACGGCAGACTTTTTCGACGAGGCTTGGTCACGCGGC
ATTGGCACCGGCGGCGACGGCAGGTTTGATCTCGTATTTGACTATACGGTGATGGCGCCCCTCTCCCCCTAGTTT
CTCATCTTGCTCTGCATCTTGACCTTGGCCTGCGCGCGACGACTAACCCGCTCTGCCAGTTTCTCTGCGCCCTGC
CCATTGCTGCTCGTCCCCAGTGGGCCAAGCGCATGTCCAGCCTGGTGCGCCCTCGCGGCCGCCTCATCTGCCTCG
AGTTTCCCTCCAGCAAGCCTCTTCTTGAGCCAGGCCCGCCATGGCCCATGCGGCCCGAGGTATATGAGGCGCTGC
TCGCTGCTCCGGGCCAAGACGCTGTATACGATGCCGACGGGTCCATTGTCTGCTCCGTCAATGCCAAGCCCAGCC
ATGGCGCTCTGCACCGCCTGGGCATCATCAAGCCTGAGCGCACTCATCCCGCGGGTACGGCGCCCGATGGCTCCG
TCATTGACTTCATCTCCATCTGGGCGCCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail