Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5310
Gene name
LocationContig_4:310913..311990
Strand+
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02338 OTU OTU-like cysteine protease 8.5E-14 254 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38747|OTU2_YEAST OTU domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OTU2 PE=1 SV=1 1 353 9.0E-35
sp|Q9UUK3|OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=otu2 PE=3 SV=1 4 353 3.0E-25
sp|Q8N6M0|OTU6B_HUMAN OTU domain-containing protein 6B OS=Homo sapiens GN=OTUD6B PE=1 SV=1 163 353 2.0E-20
sp|Q8K2H2|OTU6B_MOUSE OTU domain-containing protein 6B OS=Mus musculus GN=Otud6b PE=1 SV=1 11 353 1.0E-19
sp|Q6GM06|OTU6B_XENLA OTU domain-containing protein 6B OS=Xenopus laevis GN=otud6b PE=2 SV=1 156 353 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38747|OTU2_YEAST OTU domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OTU2 PE=1 SV=1 1 353 9.0E-35
sp|Q9UUK3|OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=otu2 PE=3 SV=1 4 353 3.0E-25
sp|Q8N6M0|OTU6B_HUMAN OTU domain-containing protein 6B OS=Homo sapiens GN=OTUD6B PE=1 SV=1 163 353 2.0E-20
sp|Q8K2H2|OTU6B_MOUSE OTU domain-containing protein 6B OS=Mus musculus GN=Otud6b PE=1 SV=1 11 353 1.0E-19
sp|Q6GM06|OTU6B_XENLA OTU domain-containing protein 6B OS=Xenopus laevis GN=otud6b PE=2 SV=1 156 353 6.0E-18
sp|Q5ZIP6|OTU6B_CHICK OTU domain-containing protein 6B OS=Gallus gallus GN=OTUD6B PE=2 SV=1 11 357 1.0E-17
sp|Q7ZV00|OTU6B_DANRE OTU domain-containing protein 6B OS=Danio rerio GN=otud6b PE=2 SV=1 11 353 9.0E-17
sp|Q5M8L0|OTU6B_XENTR OTU domain-containing protein 6B OS=Xenopus tropicalis GN=otud6b PE=2 SV=1 138 353 1.0E-16
sp|Q7L8S5|OTU6A_HUMAN OTU domain-containing protein 6A OS=Homo sapiens GN=OTUD6A PE=1 SV=1 188 353 6.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6143
Ophiocordyceps australis map64 (Brazil) OphauB2|5310 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02053
Ophiocordyceps camponoti-floridani Ophcf2|07437
Ophiocordyceps camponoti-rufipedis Ophun1|7015
Ophiocordyceps kimflemingae Ophio5|7398
Ophiocordyceps subramaniannii Hirsu2|792

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5310
MEAKRMQESTEQMQARHQREQEALQTRTSSKKRNASKKTRKGVMQECERLERELRERQDKERASAAGEAGQEEGE
EEEEAGDADGQEEKEAEERVAAAVDKLRHAQDELVTATQGMELRDRNGHGQDGLAGGKKRNRQRERLARRAAAQE
AAACAAEEEASQMTNHRSLEAEAMQQAMTQHGLVEVQVPPDGHCLFSAVADQLDDKKISLCPLTALSASAAASAT
TTTAAASATASAATATATATATTTTLPPYKTLRRAAAEYMLAHADDFAPYLDDGDDLASYAARMRDTAEWGGHME
LLALARTYDALICVLHDGRIERVGGARQKGEEKALWLAYYRHGFGLGAHYNSLRSKTA*
Coding >OphauB2|5310
ATGGAAGCCAAGAGGATGCAAGAGTCGACGGAGCAAATGCAAGCGCGACACCAGCGCGAGCAAGAGGCGCTGCAG
ACGCGTACAAGTAGCAAGAAGCGCAACGCGAGCAAAAAGACACGCAAGGGCGTGATGCAAGAGTGCGAGCGACTG
GAGCGGGAGCTGCGAGAGCGACAGGACAAGGAGCGAGCAAGTGCGGCGGGCGAGGCTGGGCAAGAGGAAGGAGAA
GAAGAAGAAGAAGCGGGCGATGCGGATGGGCAAGAAGAAAAAGAGGCAGAGGAGCGAGTGGCGGCTGCGGTGGAC
AAGCTGCGACATGCGCAGGATGAGCTGGTGACGGCGACGCAAGGAATGGAGCTGAGGGACAGAAACGGGCACGGG
CAAGACGGTCTGGCAGGAGGCAAGAAGCGCAACAGGCAGCGGGAGAGACTGGCGCGACGTGCAGCTGCGCAAGAA
GCGGCAGCGTGTGCGGCCGAGGAGGAAGCGTCGCAAATGACCAACCACCGCTCCCTCGAAGCCGAAGCGATGCAG
CAAGCCATGACGCAGCACGGGCTCGTCGAGGTGCAAGTCCCGCCCGACGGCCACTGTCTCTTTTCTGCCGTGGCG
GATCAGCTAGACGACAAGAAGATTTCTCTATGCCCCTTGACAGCTTTATCTGCCTCTGCTGCTGCTTCTGCTACT
ACTACTACTGCTGCTGCTTCTGCTACTGCTTCTGCTGCTACTGCTACTGCTACTGCTACTGCTACTACTACTACG
CTCCCGCCATACAAGACGCTGCGCCGCGCGGCTGCAGAATACATGCTTGCCCACGCAGACGACTTTGCGCCCTAT
CTCGACGACGGCGACGACTTGGCCTCGTATGCGGCGCGGATGCGCGACACGGCAGAGTGGGGGGGACACATGGAG
CTGCTGGCGCTGGCGCGGACCTATGATGCCTTGATTTGCGTCTTGCACGACGGACGCATCGAGAGAGTGGGCGGT
GCGCGCCAAAAGGGCGAGGAAAAGGCGCTGTGGCTGGCTTATTATAGACATGGCTTTGGCTTGGGGGCGCACTAC
AACTCGCTGCGCAGCAAGACGGCATAG
Transcript >OphauB2|5310
ATGGAAGCCAAGAGGATGCAAGAGTCGACGGAGCAAATGCAAGCGCGACACCAGCGCGAGCAAGAGGCGCTGCAG
ACGCGTACAAGTAGCAAGAAGCGCAACGCGAGCAAAAAGACACGCAAGGGCGTGATGCAAGAGTGCGAGCGACTG
GAGCGGGAGCTGCGAGAGCGACAGGACAAGGAGCGAGCAAGTGCGGCGGGCGAGGCTGGGCAAGAGGAAGGAGAA
GAAGAAGAAGAAGCGGGCGATGCGGATGGGCAAGAAGAAAAAGAGGCAGAGGAGCGAGTGGCGGCTGCGGTGGAC
AAGCTGCGACATGCGCAGGATGAGCTGGTGACGGCGACGCAAGGAATGGAGCTGAGGGACAGAAACGGGCACGGG
CAAGACGGTCTGGCAGGAGGCAAGAAGCGCAACAGGCAGCGGGAGAGACTGGCGCGACGTGCAGCTGCGCAAGAA
GCGGCAGCGTGTGCGGCCGAGGAGGAAGCGTCGCAAATGACCAACCACCGCTCCCTCGAAGCCGAAGCGATGCAG
CAAGCCATGACGCAGCACGGGCTCGTCGAGGTGCAAGTCCCGCCCGACGGCCACTGTCTCTTTTCTGCCGTGGCG
GATCAGCTAGACGACAAGAAGATTTCTCTATGCCCCTTGACAGCTTTATCTGCCTCTGCTGCTGCTTCTGCTACT
ACTACTACTGCTGCTGCTTCTGCTACTGCTTCTGCTGCTACTGCTACTGCTACTGCTACTGCTACTACTACTACG
CTCCCGCCATACAAGACGCTGCGCCGCGCGGCTGCAGAATACATGCTTGCCCACGCAGACGACTTTGCGCCCTAT
CTCGACGACGGCGACGACTTGGCCTCGTATGCGGCGCGGATGCGCGACACGGCAGAGTGGGGGGGACACATGGAG
CTGCTGGCGCTGGCGCGGACCTATGATGCCTTGATTTGCGTCTTGCACGACGGACGCATCGAGAGAGTGGGCGGT
GCGCGCCAAAAGGGCGAGGAAAAGGCGCTGTGGCTGGCTTATTATAGACATGGCTTTGGCTTGGGGGCGCACTAC
AACTCGCTGCGCAGCAAGACGGCATAG
Gene >OphauB2|5310
ATGGAAGCCAAGAGGATGCAAGAGTCGACGGAGCAAATGCAAGCGCGACACCAGCGCGAGCAAGAGGCGCTGCAG
ACGCGTACAAGTAGCAAGAAGCGCAACGCGAGCAAAAAGACACGCAAGGGCGTGATGCAAGAGTGCGAGCGACTG
GAGCGGGAGCTGCGAGAGCGACAGGACAAGGAGCGAGCAAGTGCGGCGGGCGAGGCTGGGCAAGAGGAAGGAGAA
GAAGAAGAAGAAGCGGGCGATGCGGATGGGCAAGAAGAAAAAGAGGCAGAGGAGCGAGTGGCGGCTGCGGTGGAC
AAGCTGCGACATGCGCAGGATGAGCTGGTGACGGCGACGCAAGGAATGGAGCTGAGGGACAGAAACGGGCACGGG
CAAGACGGTCTGGCAGGAGGCAAGAAGCGCAACAGGCAGCGGGAGAGACTGGCGCGACGTGCAGCTGCGCAAGAA
GCGGCAGCGTGTGCGGCCGAGGAGGAAGCGTCGCAAATGACCAACCACCGCTCCCTCGAAGCCGAAGCGATGCAG
CAAGCCATGACGCAGCACGGGCTCGTCGAGGTGCAAGTCCCGCCCGACGGCCACTGTCTCTTTTCTGCCGTGGCG
GATCAGCTAGACGACAAGAAGATTTCTCTATGCCCCTTGACAGCTTTATCTGCCTCTGCTGCTGCTTCTGCTACT
ACTACTACTGCTGCTGCTTCTGCTACTGCTTCTGCTGCTACTGCTACTGCTACTGCTACTGCTACTACTACTACG
CTCCCGCCATACAAGACGCTGCGCCGCGCGGCTGCAGAATACATGCTTGCCCACGCAGACGACTTTGCGCCCTAT
CTCGACGACGGCGACGACTTGGCCTCGTATGCGGCGCGGATGCGCGACACGGCAGAGTGGGGGGGACACATGGAG
CTGCTGGCGCTGGCGCGGACCTATGATGCCTTGATTTGCGTCTTGCACGACGGACGCATCGAGAGAGTGGGCGGT
GCGCGCCAAAAGGGCGAGGAAAAGGCGCTGTGGCTGGCTTATTATAGACATGGCTTTGGCTTGGGGGCGCACTAC
AACTCGCTGCGCAGCAAGACGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail