Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5297
Gene name
LocationContig_4:273110..275277
Strand+
Gene length (bp)2167
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08646 Rep_fac-A_C Replication factor-A C terminal domain 8.5E-55 468 613
PF16900 REPA_OB_2 Replication protein A OB domain 4.6E-38 312 408
PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain 8.5E-20 30 129
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 1.4E-08 203 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92372|RFA1_SCHPO Replication factor A protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb1 PE=1 SV=1 25 617 0.0E+00
sp|Q6NY74|RFA1_DANRE Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio GN=rpa1 PE=1 SV=1 50 619 4.0E-135
sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens GN=RPA1 PE=1 SV=2 28 619 1.0E-133
sp|Q5R7Q4|RFA1_PONAB Replication protein A 70 kDa DNA-binding subunit OS=Pongo abelii GN=RPA1 PE=2 SV=1 28 619 2.0E-131
sp|P22336|RFA1_YEAST Replication factor A protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA1 PE=1 SV=1 28 617 4.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92372|RFA1_SCHPO Replication factor A protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb1 PE=1 SV=1 25 617 0.0E+00
sp|Q6NY74|RFA1_DANRE Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio GN=rpa1 PE=1 SV=1 50 619 4.0E-135
sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens GN=RPA1 PE=1 SV=2 28 619 1.0E-133
sp|Q5R7Q4|RFA1_PONAB Replication protein A 70 kDa DNA-binding subunit OS=Pongo abelii GN=RPA1 PE=2 SV=1 28 619 2.0E-131
sp|P22336|RFA1_YEAST Replication factor A protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA1 PE=1 SV=1 28 617 4.0E-131
sp|Q8VEE4|RFA1_MOUSE Replication protein A 70 kDa DNA-binding subunit OS=Mus musculus GN=Rpa1 PE=1 SV=1 28 619 3.0E-124
sp|Q01588|RFA1_XENLA Replication protein A 70 kDa DNA-binding subunit OS=Xenopus laevis GN=rpa1 PE=1 SV=1 50 619 1.0E-122
sp|Q5FW17|RFA1_XENTR Replication protein A 70 kDa DNA-binding subunit OS=Xenopus tropicalis GN=rpa1 PE=2 SV=1 24 619 1.0E-122
sp|Q5ZJJ2|RFA1_CHICK Replication protein A 70 kDa DNA-binding subunit OS=Gallus gallus GN=RPA1 PE=2 SV=1 50 619 1.0E-117
sp|Q24492|RFA1_DROME Replication protein A 70 kDa DNA-binding subunit OS=Drosophila melanogaster GN=RpA-70 PE=1 SV=1 50 607 1.0E-114
sp|Q9SKI4|RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A OS=Arabidopsis thaliana GN=RPA1A PE=1 SV=1 50 617 4.0E-98
sp|Q6YZ49|RFA1A_ORYSJ Replication protein A 70 kDa DNA-binding subunit A OS=Oryza sativa subsp. japonica GN=RPA1A PE=1 SV=1 50 617 3.0E-94
sp|Q10Q08|RFA1B_ORYSJ Replication protein A 70 kDa DNA-binding subunit B OS=Oryza sativa subsp. japonica GN=RPA1B PE=1 SV=1 23 617 7.0E-89
sp|Q9FHJ6|RFA1C_ARATH Replication protein A 70 kDa DNA-binding subunit C OS=Arabidopsis thaliana GN=RPA1C PE=3 SV=1 145 622 2.0E-87
sp|F4JSG3|RFA1E_ARATH Replication protein A 70 kDa DNA-binding subunit E OS=Arabidopsis thaliana GN=RPA1E PE=2 SV=1 190 624 2.0E-84
sp|Q9SD82|RFA1B_ARATH Replication protein A 70 kDa DNA-binding subunit B OS=Arabidopsis thaliana GN=RPA1B PE=3 SV=1 26 613 3.0E-83
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 153 617 6.0E-83
sp|Q9FME0|RFA1D_ARATH Replication protein A 70 kDa DNA-binding subunit D OS=Arabidopsis thaliana GN=RPA1D PE=2 SV=1 67 613 3.0E-72
sp|Q23696|RFA1_CRIFA Replication factor A 51 kDa subunit OS=Crithidia fasciculata GN=RPA1 PE=1 SV=1 181 591 1.0E-65
sp|Q19537|RFA1_CAEEL Probable replication factor A 73 kDa subunit OS=Caenorhabditis elegans GN=rpa-1 PE=1 SV=1 147 619 8.0E-52
sp|O97472|RFA1_CAEBR Probable replication factor A 73 kDa subunit OS=Caenorhabditis briggsae GN=rpa-1 PE=3 SV=1 190 619 1.0E-51
sp|F4JSG3|RFA1E_ARATH Replication protein A 70 kDa DNA-binding subunit E OS=Arabidopsis thaliana GN=RPA1E PE=2 SV=1 49 141 2.0E-09
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 28 154 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006260 DNA replication Yes
GO:0005634 nucleus Yes
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5297
MFNSTTDLAKTFDKSKLQPARMDAASLISRGSLDVIFNDPDKAAKLFPVPILQCLQIKQMAPSAQGGDRYRLVMS
DGQHYVQTMLATQANHVVHDDKLLRGSLARIKQYTPNNLKGKNILIIIDLEAVEGGVHDKIGDPSPLDARAPTET
TIPSNDFYGAKKEESKSQVQAQKAQQSMPSRPAMHAGSNIYPIEGLSPFAHKWTIKARVTVKSDIKTWHKATGEG
KLFSVNLLDESSEIKATGFNEQCDAFYDLFEQGCVYYISSPCRVQLAKKQFSNLPNDYELTFERDTVIEKAEDQS
NVPQVRFNFCTIQELQSVEKDNTIDVIGVLKEVAEVTEITSKKDGRPFQKRELTLVDDTGYSVRVTVWGKTASSF
AANPESVVAFKGVKVSDFGGKSLSLLSSGTMTLDPDIADAHRLKGWYDSAGRSDTFATHQGLASMGGATGRRDEV
KTIAQVKEDGLGVDDVAYYTLKATIVFVKQDNFCYPACSSPSCNKKVTPMGDGTWHCEKCNVSHDKPNYRYILSL
NVADHTSHQWLSCFDETGALILGRTANELMELKDNDEGRFMAAFEDVNCKKLIFRCRAKMDNYGDAQRVRYQVMS
AAFLDYKAEAHKLADMIRQYDINS*
Coding >OphauB2|5297
ATGTTCAACAGCACAACCGACTTGGCCAAGACGTTTGACAAGAGCAAACTACAGCCAGCAAGGATGGATGCCGCG
TCGCTTATTTCCCGGGGATCCCTCGACGTCATTTTTAATGACCCCGACAAGGCCGCCAAGCTATTCCCCGTGCCC
ATTTTGCAATGCCTGCAGATCAAGCAGATGGCGCCGTCGGCGCAGGGCGGTGATCGATACCGGCTCGTCATGAGC
GATGGACAGCATTATGTGCAGACGATGCTGGCCACTCAAGCCAACCATGTGGTTCACGACGACAAGCTCCTTCGC
GGATCTCTGGCTCGCATCAAGCAGTACACGCCGAATAACCTCAAGGGGAAGAACATTCTCATCATTATTGACCTG
GAAGCCGTGGAAGGCGGTGTGCACGACAAGATTGGCGATCCTAGCCCGCTGGACGCGAGGGCACCGACGGAGACG
ACGATTCCGAGCAACGACTTTTATGGAGCGAAGAAGGAGGAGAGCAAGTCGCAGGTGCAGGCGCAAAAGGCGCAG
CAGTCGATGCCCTCGCGGCCAGCGATGCACGCGGGCAGCAACATCTACCCCATAGAGGGCCTGTCGCCCTTTGCG
CACAAGTGGACCATCAAGGCGCGAGTGACGGTCAAGTCAGACATCAAGACGTGGCACAAGGCGACTGGGGAGGGC
AAGCTGTTTAGCGTCAACCTGCTGGACGAGAGCAGCGAGATCAAGGCGACGGGCTTCAACGAGCAGTGCGATGCC
TTTTACGACTTGTTTGAGCAAGGCTGCGTCTACTACATTTCGAGCCCGTGCCGGGTGCAGCTGGCCAAGAAGCAA
TTCTCCAACCTGCCCAACGACTATGAGCTCACGTTTGAGCGCGACACGGTGATTGAAAAGGCAGAGGACCAGAGC
AACGTGCCGCAGGTGCGCTTCAACTTTTGCACGATCCAGGAGCTGCAGAGCGTGGAAAAGGACAATACGATTGAT
GTGATTGGCGTGCTCAAGGAGGTGGCCGAGGTGACGGAAATCACATCCAAGAAGGACGGGCGGCCCTTTCAGAAG
CGCGAGCTGACGCTTGTCGACGACACGGGCTACTCGGTGCGCGTCACCGTCTGGGGCAAGACGGCGAGCAGCTTC
GCGGCCAACCCCGAGTCGGTGGTGGCCTTTAAAGGCGTCAAGGTGTCCGACTTTGGCGGCAAGAGCCTGAGCCTG
CTGTCGTCGGGCACCATGACGCTGGACCCCGACATTGCCGACGCGCACCGCCTCAAGGGCTGGTACGACTCGGCC
GGCCGCAGCGACACGTTTGCCACGCACCAAGGACTGGCCAGCATGGGCGGCGCCACGGGCCGGCGCGACGAGGTC
AAGACGATTGCCCAGGTCAAGGAGGACGGCCTGGGCGTCGACGACGTGGCCTACTACACCCTCAAGGCCACCATT
GTCTTTGTCAAGCAGGACAACTTTTGCTATCCGGCCTGCTCCTCCCCGTCGTGCAATAAAAAGGTGACGCCCATG
GGCGACGGCACCTGGCACTGCGAAAAGTGCAACGTGTCGCACGACAAGCCAAACTACCGCTACATTTTATCCCTA
AACGTGGCGGACCATACTAGTCACCAGTGGCTCAGCTGCTTTGACGAGACGGGCGCGCTCATTCTCGGCCGCACT
GCCAATGAGCTTATGGAGCTCAAGGATAACGACGAGGGTCGCTTCATGGCTGCGTTTGAGGATGTCAATTGCAAA
AAGCTCATTTTTCGGTGCCGCGCAAAAATGGACAATTACGGCGATGCTCAGAGGGTGCGATATCAAGTCATGAGC
GCAGCCTTCCTCGACTACAAGGCCGAGGCCCACAAGCTGGCCGACATGATTCGACAATACGACATCAACTCGTAA
Transcript >OphauB2|5297
ATGTTCAACAGCACAACCGACTTGGCCAAGACGTTTGACAAGAGCAAACTACAGCCAGCAAGGATGGATGCCGCG
TCGCTTATTTCCCGGGGATCCCTCGACGTCATTTTTAATGACCCCGACAAGGCCGCCAAGCTATTCCCCGTGCCC
ATTTTGCAATGCCTGCAGATCAAGCAGATGGCGCCGTCGGCGCAGGGCGGTGATCGATACCGGCTCGTCATGAGC
GATGGACAGCATTATGTGCAGACGATGCTGGCCACTCAAGCCAACCATGTGGTTCACGACGACAAGCTCCTTCGC
GGATCTCTGGCTCGCATCAAGCAGTACACGCCGAATAACCTCAAGGGGAAGAACATTCTCATCATTATTGACCTG
GAAGCCGTGGAAGGCGGTGTGCACGACAAGATTGGCGATCCTAGCCCGCTGGACGCGAGGGCACCGACGGAGACG
ACGATTCCGAGCAACGACTTTTATGGAGCGAAGAAGGAGGAGAGCAAGTCGCAGGTGCAGGCGCAAAAGGCGCAG
CAGTCGATGCCCTCGCGGCCAGCGATGCACGCGGGCAGCAACATCTACCCCATAGAGGGCCTGTCGCCCTTTGCG
CACAAGTGGACCATCAAGGCGCGAGTGACGGTCAAGTCAGACATCAAGACGTGGCACAAGGCGACTGGGGAGGGC
AAGCTGTTTAGCGTCAACCTGCTGGACGAGAGCAGCGAGATCAAGGCGACGGGCTTCAACGAGCAGTGCGATGCC
TTTTACGACTTGTTTGAGCAAGGCTGCGTCTACTACATTTCGAGCCCGTGCCGGGTGCAGCTGGCCAAGAAGCAA
TTCTCCAACCTGCCCAACGACTATGAGCTCACGTTTGAGCGCGACACGGTGATTGAAAAGGCAGAGGACCAGAGC
AACGTGCCGCAGGTGCGCTTCAACTTTTGCACGATCCAGGAGCTGCAGAGCGTGGAAAAGGACAATACGATTGAT
GTGATTGGCGTGCTCAAGGAGGTGGCCGAGGTGACGGAAATCACATCCAAGAAGGACGGGCGGCCCTTTCAGAAG
CGCGAGCTGACGCTTGTCGACGACACGGGCTACTCGGTGCGCGTCACCGTCTGGGGCAAGACGGCGAGCAGCTTC
GCGGCCAACCCCGAGTCGGTGGTGGCCTTTAAAGGCGTCAAGGTGTCCGACTTTGGCGGCAAGAGCCTGAGCCTG
CTGTCGTCGGGCACCATGACGCTGGACCCCGACATTGCCGACGCGCACCGCCTCAAGGGCTGGTACGACTCGGCC
GGCCGCAGCGACACGTTTGCCACGCACCAAGGACTGGCCAGCATGGGCGGCGCCACGGGCCGGCGCGACGAGGTC
AAGACGATTGCCCAGGTCAAGGAGGACGGCCTGGGCGTCGACGACGTGGCCTACTACACCCTCAAGGCCACCATT
GTCTTTGTCAAGCAGGACAACTTTTGCTATCCGGCCTGCTCCTCCCCGTCGTGCAATAAAAAGGTGACGCCCATG
GGCGACGGCACCTGGCACTGCGAAAAGTGCAACGTGTCGCACGACAAGCCAAACTACCGCTACATTTTATCCCTA
AACGTGGCGGACCATACTAGTCACCAGTGGCTCAGCTGCTTTGACGAGACGGGCGCGCTCATTCTCGGCCGCACT
GCCAATGAGCTTATGGAGCTCAAGGATAACGACGAGGGTCGCTTCATGGCTGCGTTTGAGGATGTCAATTGCAAA
AAGCTCATTTTTCGGTGCCGCGCAAAAATGGACAATTACGGCGATGCTCAGAGGGTGCGATATCAAGTCATGAGC
GCAGCCTTCCTCGACTACAAGGCCGAGGCCCACAAGCTGGCCGACATGATTCGACAATACGACATCAACTCGTAA
Gene >OphauB2|5297
ATGTTCAACAGCACAACCGACTTGGCCAAGACGTTTGACAAGAGCAAACTACAGCCAGCAAGGATGGATGCCGCG
TCGCTTATTTCCCGGGGATCCCTCGAGTAGGTCTACTCTGTCATATGCTATAAATGAACCCAGTTGCTGACTTGG
AAACAGCGTCATTTTTAATGACCCCGACAAGGCCGCCAAGCTATTCCCCGTGCCCATTTTGCAATGCCTGCAGAT
CAAGCAGATGGCGCCGTCGGCGCAGGGCGGTGATCGATACCGGCTCGTCATGAGCGATGGACAGCATTATGTGCA
GACGATGCTGGCCACTCAAGCCAACCATGTGGTTCACGACGACAAGCTCCTTCGCGGATCTCTGGCTCGCATCAA
GCAGTACACGCCGAATAACCTCAAGGGGAAGAAGTAAGCTGGAGATGCTGGCGTCGGGAAGAAGTGACTATGGCT
TGGCTGACTGTTGGCCAGCATTCTCATCATTATTGACCTGGAAGCCGTGGAAGGCGGTGTGCACGACAAGATTGG
CGATCCTAGCCCGCTGGACGCGAGGGCACCGACGGAGACGACGATTCCGAGCAACGACTTTTATGGAGCGAAGAA
GGAGGAGAGCAAGTCGCAGGTGCAGGCGCAAAAGGCGCAGCAGTCGATGCCCTCGCGGCCAGCGATGCACGCGGG
CAGCAACATCTACCCCATAGAGGGCCTGTCGCCCTTTGCGCACAAGTGGACCATCAAGGCGCGAGTGACGGTCAA
GTCAGACATCAAGACGTGGCACAAGGCGACTGGGGAGGGCAAGCTGTTTAGCGTCAACCTGCTGGACGAGAGCAG
CGAGATCAAGGCGACGGGCTTCAACGAGCAGTGCGATGCCTTTTACGACTTGTTTGAGCAAGGCTGCGTCTACTA
CATTTCGAGCCCGTGCCGGGTGCAGCTGGCCAAGAAGCAATTCTCCAACCTGCCCAACGACTATGAGCTCACGTT
TGAGCGCGACACGGTGATTGAAAAGGCAGAGGACCAGAGCAACGTGCCGCAGGTGCGCTTCAACTTTTGCACGAT
CCAGGAGCTGCAGAGCGTGGAAAAGGACAATACGATTGATGTGATTGGCGTGCTCAAGGAGGTGGCCGAGGTGAC
GGAAATCACATCCAAGAAGGACGGGCGGCCCTTTCAGAAGCGCGAGCTGACGCTTGTCGACGACACGGGCTACTC
GGTGCGCGTCACCGTCTGGGGCAAGACGGCGAGCAGCTTCGCGGCCAACCCCGAGTCGGTGGTGGCCTTTAAAGG
CGTCAAGGTGTCCGACTTTGGCGGCAAGAGCCTGAGCCTGCTGTCGTCGGGCACCATGACGCTGGACCCCGACAT
TGCCGACGCGCACCGCCTCAAGGGCTGGTACGACTCGGCCGGCCGCAGCGACACGTTTGCCACGCACCAAGGACT
GGCCAGCATGGGCGGCGCCACGGGCCGGCGCGACGAGGTCAAGACGATTGCCCAGGTCAAGGAGGACGGCCTGGG
CGTCGACGACGTGGCCTACTACACCCTCAAGGCCACCATTGTCTTTGTCAAGCAGGACAACTTTTGCTATCCGGC
CTGCTCCTCCCCGTCGTGCAATAAAAAGGTGACGCCCATGGGCGACGGCACCTGGCACTGCGAAAAGTGCAACGT
GTCGCACGACAAGCCAAACTACCGCTACATTTTATCCCTAAACGTGGCGGACCATACTAGTCACCAGTGGCTCAG
CTGCTTTGACGAGACGGGCGCGCTCATTCTCGGCCGCACTGCCAATGAGCTTATGGAGCTCAAGGATAACGACGA
GGGTCGCTTCATGGCTGCGTTTGAGGATGTCAATTGCAAAAAGCTCATTTTTCGGTGCCGCGCAAAAATGGACAA
TTACGGCGATGCTCAGAGGTTGGTAAAAACAGTCTTTGCTTTTTCTTTTTTTTCCTTTTTTTTCCTTTTTTCCCC
CTTTCTTTGAGGGGCAGGGAGTTTTTATTATTATTATTATTATTATTTTGCATCGTTTGGCATGCAATTCTGCAT
CTCAGTCTGGCCCTGCTGCATCGTGCTGACAATGGGCAAAAACAGGGTGCGATATCAAGTCATGAGCGCAGCCTT
CCTCGACTACAAGGCCGAGGCCCACAAGCTGGCCGACATGATTCGACAATACGACATCAACTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail