Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5286
Gene name
LocationContig_4:235413..236552
Strand+
Gene length (bp)1139
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 8.8E-20 11 342

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A3LZU8|RMGL_PICST L-rhamnono-gamma-lactonase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LRA2 PE=1 SV=2 10 343 4.0E-36

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5286
MADAHRQLPIIDAHIHLWPSAEASSLAWYSPSHPLLSQQSMTQYRAATAPAPCLAGFVFVEADRKHKLDTEDWTG
PLDEVRWMRRLLVGQPRDGEGHTAADASLCLGLVPWAPVPCGPDVLQRYLHEAEQAAGEAWPKVKGFRYLLQDKP
AGTMLEKDFIDSLKLLGRKRFVFEVAVDQHRRGNKHLEEVVEMVGRAHQDVPEEEKVVFVLDHFGKPDLGVYNVT
CDPAFIAWRTAMYTLSKDSHTYIKLSGAFAEMPESLRVMSPFHIFQALLAWFVVLTTTFGPGRLMFGSDWPLCSL
DGLGDEGWDKWRLVVDKMCWMAGLDDIGRAMVFGGTAKQAYSLAD*
Coding >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGACCACTTTGGCAAGCCAGACCTTGGCGTCTACAATGTCACT
TGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCAAGGATTCGCACACGTATATCAAGCTC
TCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCTTTCACATTTTTCAGGCCCTGCTCGCC
TGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTGGCTCCGACTGGCCCTTGTGCTCCCTC
GACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACAAGATGTGCTGGATGGCTGGTCTAGAC
GACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATAGCCTTGCTGACTAG
Transcript >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGACCACTTTGGCAAGCCAGACCTTGGCGTCTACAATGTCACT
TGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCAAGGATTCGCACACGTATATCAAGCTC
TCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCTTTCACATTTTTCAGGCCCTGCTCGCC
TGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTGGCTCCGACTGGCCCTTGTGCTCCCTC
GACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACAAGATGTGCTGGATGGCTGGTCTAGAC
GACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATAGCCTTGCTGACTAG
Gene >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGGTGCTTTGCCCATTGTCGCTTTTGGCCCCCCTTGCTGCTGG
AATTTGCTTGCTAATGCAAAGAGGGAATCAAAACTAAAAAAACTCTGCCCCCCCCGCCAGACCACTTTGGCAAGC
CAGACCTTGGCGTCTACAATGTCACTTGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCA
AGGATTCGCACACGTATATCAAGCTCTCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCT
TTCACATTTTTCAGGCCCTGCTCGCCTGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTG
GCTCCGACTGGCCCTTGTGCTCCCTCGACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACA
AGATGTGCTGGATGGCTGGTCTAGACGACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATA
GCCTTGCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail