Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5286
Gene name
LocationContig_4:235413..236552
Strand+
Gene length (bp)1139
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 8.8E-20 11 342

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A3LZU8|RMGL_PICST L-rhamnono-gamma-lactonase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LRA2 PE=1 SV=2 10 343 4.0E-36

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup926
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7349
Ophiocordyceps australis map64 (Brazil) OphauB2|5286 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02071
Ophiocordyceps camponoti-floridani Ophcf2|07421
Ophiocordyceps camponoti-rufipedis Ophun1|723
Ophiocordyceps kimflemingae Ophio5|3909
Ophiocordyceps subramaniannii Hirsu2|6485

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5286
MADAHRQLPIIDAHIHLWPSAEASSLAWYSPSHPLLSQQSMTQYRAATAPAPCLAGFVFVEADRKHKLDTEDWTG
PLDEVRWMRRLLVGQPRDGEGHTAADASLCLGLVPWAPVPCGPDVLQRYLHEAEQAAGEAWPKVKGFRYLLQDKP
AGTMLEKDFIDSLKLLGRKRFVFEVAVDQHRRGNKHLEEVVEMVGRAHQDVPEEEKVVFVLDHFGKPDLGVYNVT
CDPAFIAWRTAMYTLSKDSHTYIKLSGAFAEMPESLRVMSPFHIFQALLAWFVVLTTTFGPGRLMFGSDWPLCSL
DGLGDEGWDKWRLVVDKMCWMAGLDDIGRAMVFGGTAKQAYSLAD*
Coding >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGACCACTTTGGCAAGCCAGACCTTGGCGTCTACAATGTCACT
TGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCAAGGATTCGCACACGTATATCAAGCTC
TCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCTTTCACATTTTTCAGGCCCTGCTCGCC
TGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTGGCTCCGACTGGCCCTTGTGCTCCCTC
GACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACAAGATGTGCTGGATGGCTGGTCTAGAC
GACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATAGCCTTGCTGACTAG
Transcript >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGACCACTTTGGCAAGCCAGACCTTGGCGTCTACAATGTCACT
TGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCAAGGATTCGCACACGTATATCAAGCTC
TCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCTTTCACATTTTTCAGGCCCTGCTCGCC
TGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTGGCTCCGACTGGCCCTTGTGCTCCCTC
GACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACAAGATGTGCTGGATGGCTGGTCTAGAC
GACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATAGCCTTGCTGACTAG
Gene >OphauB2|5286
ATGGCCGACGCTCACCGTCAGCTCCCCATCATTGACGCCCACATTCATCTCTGGCCCTCTGCCGAAGCCTCAAGC
CTAGCATGGTATTCTCCCTCGCACCCCCTCCTCTCCCAACAATCTATGACGCAGTACCGCGCCGCCACGGCCCCC
GCCCCTTGTCTTGCCGGCTTCGTCTTTGTCGAGGCGGACCGCAAGCACAAGCTCGACACAGAGGACTGGACCGGC
CCCCTTGACGAAGTGCGCTGGATGCGCCGCCTGCTTGTCGGCCAGCCCCGCGACGGCGAGGGCCATACTGCCGCA
GACGCAAGCCTCTGTCTGGGCCTGGTGCCCTGGGCGCCCGTGCCCTGCGGACCGGACGTTTTGCAGCGCTACCTG
CACGAGGCGGAGCAGGCGGCTGGCGAGGCGTGGCCCAAGGTAAAGGGCTTTAGGTATCTGTTGCAGGATAAACCG
GCCGGGACCATGCTGGAAAAGGACTTTATCGACTCGCTCAAGCTGCTGGGCCGCAAGCGCTTCGTCTTTGAAGTG
GCTGTTGACCAGCACCGCCGCGGCAACAAGCATCTCGAAGAGGTTGTGGAAATGGTGGGCCGCGCTCACCAAGAC
GTGCCCGAGGAGGAAAAGGTGGTGTTTGTGCTAGGTGCTTTGCCCATTGTCGCTTTTGGCCCCCCTTGCTGCTGG
AATTTGCTTGCTAATGCAAAGAGGGAATCAAAACTAAAAAAACTCTGCCCCCCCCGCCAGACCACTTTGGCAAGC
CAGACCTTGGCGTCTACAATGTCACTTGTGACCCAGCCTTTATTGCCTGGCGCACCGCAATGTACACCCTCTCCA
AGGATTCGCACACGTATATCAAGCTCTCGGGCGCCTTTGCCGAAATGCCAGAGTCGTTGCGCGTCATGTCCCCCT
TTCACATTTTTCAGGCCCTGCTCGCCTGGTTCGTTGTTCTAACCACCACGTTTGGTCCCGGCCGCCTCATGTTTG
GCTCCGACTGGCCCTTGTGCTCCCTCGACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCTGGTAGTGGACA
AGATGTGCTGGATGGCTGGTCTAGACGACATTGGCCGCGCCATGGTTTTTGGCGGCACCGCCAAACAGGCCTATA
GCCTTGCTGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail