Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|528
Gene name
LocationContig_109:59815..62767
Strand+
Gene length (bp)2952
Transcript length (bp)2754
Coding sequence length (bp)2754
Protein length (aa) 918

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04121 Nup84_Nup100 Nuclear pore protein 84 / 107 2.8E-161 103 883

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SER9|NUP84_CHATD Nucleoporin NUP84 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP84 PE=3 SV=1 13 917 0.0E+00
sp|Q10331|NU107_SCHPO Nucleoporin nup107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup107 PE=1 SV=4 38 876 2.0E-35
sp|Q8BH74|NU107_MOUSE Nuclear pore complex protein Nup107 OS=Mus musculus GN=Nup107 PE=1 SV=1 105 595 3.0E-12
sp|P52590|NU107_RAT Nuclear pore complex protein Nup107 OS=Rattus norvegicus GN=Nup107 PE=1 SV=1 105 595 4.0E-12
sp|P57740|NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens GN=NUP107 PE=1 SV=1 105 457 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SER9|NUP84_CHATD Nucleoporin NUP84 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP84 PE=3 SV=1 13 917 0.0E+00
sp|Q10331|NU107_SCHPO Nucleoporin nup107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup107 PE=1 SV=4 38 876 2.0E-35
sp|Q8BH74|NU107_MOUSE Nuclear pore complex protein Nup107 OS=Mus musculus GN=Nup107 PE=1 SV=1 105 595 3.0E-12
sp|P52590|NU107_RAT Nuclear pore complex protein Nup107 OS=Rattus norvegicus GN=Nup107 PE=1 SV=1 105 595 4.0E-12
sp|P57740|NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens GN=NUP107 PE=1 SV=1 105 457 2.0E-11
sp|P52891|NUP84_YEAST Nucleoporin NUP84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP84 PE=1 SV=1 316 683 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No
GO:0005198 structural molecule activity No
GO:0140513 nuclear protein-containing complex No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4039
Ophiocordyceps australis map64 (Brazil) OphauB2|528 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00129
Ophiocordyceps camponoti-rufipedis Ophun1|2961
Ophiocordyceps kimflemingae Ophio5|3811
Ophiocordyceps subramaniannii Hirsu2|1130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|528
MSLTVNQDMEDDNVEEVKPEVETRPGPHVEEFANYVDLCIAPSLSVSERKARVLELPRKFHDNANRRLLQKKHRR
VADGSGDIDMDSERWSPSFTAEELEEVDQLEKEVQTWDLVRRLLPLRFAKSRAGAPRLSLEASKHPTLRDLAETD
PILKERRAVLQWLQVTASSGPDIDELARELQQSADRGDIIAHGWLHTRSSIKLRKSVTAWPHLLDRQTRGILNSH
VNADGAPLVTQLDPDAATRQERKLEPRDEFFERSIWLGCFEHLRRGSSLKTIREWCQERTEMWRAVSASGVLLAA
DGKDSMADAPPESLVLWRRVCLSLSRNIGSDNYERAVYGILSGDISSVESVAKSWNDHLFANYNALVRARIDSFI
LGRCSPEAVSTLSQSFSSFDPQQLQGDDAGFAKRLVKSLENREDTRQEAMQPYKALQAALIADDTDAYLRAQGSL
LAEAAQNDRPLGNFSPSPLSKPADCSREKLFGSGQHEGLRVVTHVHVLLTLMRCLDASEGKTLSLGSGFETVGQE
QVIAAYTDYLQNSGLEALIPLYCSILKPPMQYEVLGNNMIKEGDAETRLLQLRLMRKVGIDSLQFTETLARLVLD
QLVLTAKVTFPSNPICILAEGPPSARYGRAILPDFLVRSGKEMTVKDEHVIRSLEWLLQVQAAWPEVARIGEQAY
KFFFTNRCLVAVSNLVKRIKFSSLIGNMMDDAEALPDTNMLEDVEFVREKLQHIGASGASAEQVKVNLRNFHDFE
ALAAALDGLETISSAMQLQLIEPPENQKDILRIAANEGPDLKTSMQPLMHSWGVASMQAGDKELGDIRQAYLPEV
ILAFVSALHFMGNNLSRDHLLEAMDLAALVAERESDVAQVFIKSKRMTELVESFAACSKALAVVTGEKRAAGSSS
KKLREMGWSRDIWVVKN*
Coding >OphauB2|528
ATGTCGCTCACGGTTAACCAAGACATGGAGGATGACAATGTGGAAGAAGTAAAGCCAGAAGTCGAGACAAGGCCG
GGGCCTCACGTCGAAGAATTTGCCAATTATGTCGATCTCTGCATCGCCCCAAGCCTGAGTGTGTCGGAAAGGAAA
GCGCGGGTGCTGGAACTTCCTCGCAAGTTTCACGACAATGCAAATCGTCGGCTACTCCAAAAGAAACACAGGCGC
GTGGCCGACGGTAGCGGAGACATTGATATGGACTCGGAGAGATGGTCTCCTAGCTTCACTGCGGAAGAGCTCGAG
GAAGTTGACCAACTTGAAAAAGAAGTTCAGACGTGGGACCTTGTTCGCCGGCTGCTGCCGCTGAGGTTTGCCAAG
TCGCGAGCTGGGGCTCCTCGCTTGTCCTTGGAAGCCTCGAAGCATCCGACTCTGCGCGACTTGGCTGAGACTGAC
CCCATTCTCAAGGAACGCCGTGCTGTTTTGCAGTGGCTACAGGTGACTGCGTCATCGGGCCCTGATATCGACGAA
CTGGCTCGCGAGCTGCAACAGAGCGCTGACCGAGGCGACATTATTGCCCATGGCTGGCTTCACACCCGCTCATCA
ATAAAGCTTCGGAAAAGCGTGACGGCATGGCCTCATTTGCTGGATCGGCAGACTCGTGGCATTTTGAATTCCCAC
GTCAATGCGGATGGAGCGCCTCTAGTCACCCAGCTGGACCCAGACGCCGCTACCCGGCAGGAACGCAAACTTGAG
CCTCGAGACGAATTCTTTGAGCGCTCAATATGGCTGGGCTGCTTTGAGCATCTTCGCCGCGGCAGCAGCCTCAAG
ACGATTCGCGAATGGTGTCAAGAGCGAACCGAAATGTGGCGGGCCGTCTCTGCGTCGGGTGTGCTTCTTGCTGCC
GACGGCAAGGACTCCATGGCCGACGCGCCTCCCGAGTCACTGGTGCTGTGGCGACGCGTGTGCCTCAGTCTATCT
CGCAATATTGGCTCGGATAATTATGAGCGCGCAGTCTATGGTATTCTGTCTGGAGACATTTCCAGTGTGGAAAGC
GTGGCAAAGAGCTGGAATGACCACTTGTTTGCCAACTATAATGCCCTTGTTCGTGCGCGCATCGATTCCTTTATA
CTGGGTAGATGCTCGCCCGAAGCAGTCTCGACGCTGTCGCAGTCGTTTTCCTCCTTTGATCCTCAACAGCTCCAA
GGCGACGATGCAGGCTTTGCTAAGCGGCTGGTCAAAAGTCTAGAAAATCGAGAGGACACCAGACAAGAGGCAATG
CAGCCGTACAAGGCGTTACAGGCTGCACTCATTGCTGACGACACAGACGCCTACCTTCGCGCACAGGGCTCACTC
TTGGCTGAGGCGGCCCAAAATGACAGGCCCTTGGGCAATTTTAGCCCAAGTCCACTGTCCAAGCCAGCCGATTGC
AGCCGAGAAAAGTTGTTTGGCTCAGGGCAACACGAGGGCTTGAGGGTTGTCACTCACGTCCATGTTCTCCTGACC
CTAATGCGATGCTTGGATGCTTCGGAAGGTAAGACACTGTCATTGGGCTCCGGCTTTGAGACGGTGGGCCAGGAG
CAAGTCATTGCCGCGTACACGGACTACTTGCAAAACTCGGGGCTCGAAGCTCTCATCCCACTCTACTGTTCCATC
CTCAAGCCACCTATGCAGTACGAAGTCCTTGGCAACAACATGATCAAGGAAGGAGACGCAGAAACACGCCTTCTT
CAGCTCCGGCTCATGAGAAAAGTTGGCATTGACTCTCTACAATTCACCGAGACGCTGGCCAGGCTTGTTCTCGAC
CAGCTTGTATTGACGGCAAAGGTGACATTTCCCTCGAATCCCATTTGCATACTGGCAGAGGGCCCGCCTAGCGCA
CGGTATGGACGAGCCATCTTGCCCGACTTTTTGGTCCGCAGCGGCAAGGAGATGACGGTCAAGGACGAGCACGTT
ATTCGTTCGCTCGAGTGGCTGCTCCAAGTCCAGGCTGCCTGGCCTGAAGTGGCTCGTATTGGAGAACAAGCATAC
AAGTTCTTTTTCACAAACAGGTGCCTTGTGGCAGTCAGCAACCTGGTGAAGCGCATCAAGTTTAGTAGTTTAATT
GGAAACATGATGGATGATGCTGAGGCGCTTCCCGATACAAACATGTTGGAAGACGTTGAATTCGTGCGGGAGAAG
CTGCAGCATATTGGCGCCTCGGGCGCCTCTGCAGAGCAAGTCAAGGTGAACCTGCGAAATTTTCACGACTTTGAG
GCTTTGGCCGCAGCGCTCGACGGCCTTGAGACAATCAGCTCTGCAATGCAGCTGCAGTTGATAGAACCACCTGAA
AATCAAAAGGACATCTTGAGGATAGCTGCAAACGAGGGCCCCGACTTGAAAACCAGTATGCAACCATTGATGCAT
AGCTGGGGAGTAGCAAGCATGCAAGCGGGCGACAAGGAGTTGGGAGATATTCGGCAGGCCTACCTGCCCGAGGTG
ATTTTGGCATTTGTGAGTGCGCTGCACTTTATGGGCAATAACCTCTCGCGAGACCACTTGCTGGAAGCCATGGAT
TTAGCAGCCCTGGTGGCAGAGCGAGAGTCGGACGTGGCGCAAGTTTTTATTAAGAGCAAGCGCATGACGGAGCTT
GTTGAGTCGTTTGCCGCATGTAGCAAAGCGCTGGCAGTGGTGACGGGAGAGAAGAGGGCGGCAGGATCAAGCAGC
AAGAAGCTGCGCGAGATGGGCTGGTCGCGCGATATCTGGGTTGTCAAGAATTAA
Transcript >OphauB2|528
ATGTCGCTCACGGTTAACCAAGACATGGAGGATGACAATGTGGAAGAAGTAAAGCCAGAAGTCGAGACAAGGCCG
GGGCCTCACGTCGAAGAATTTGCCAATTATGTCGATCTCTGCATCGCCCCAAGCCTGAGTGTGTCGGAAAGGAAA
GCGCGGGTGCTGGAACTTCCTCGCAAGTTTCACGACAATGCAAATCGTCGGCTACTCCAAAAGAAACACAGGCGC
GTGGCCGACGGTAGCGGAGACATTGATATGGACTCGGAGAGATGGTCTCCTAGCTTCACTGCGGAAGAGCTCGAG
GAAGTTGACCAACTTGAAAAAGAAGTTCAGACGTGGGACCTTGTTCGCCGGCTGCTGCCGCTGAGGTTTGCCAAG
TCGCGAGCTGGGGCTCCTCGCTTGTCCTTGGAAGCCTCGAAGCATCCGACTCTGCGCGACTTGGCTGAGACTGAC
CCCATTCTCAAGGAACGCCGTGCTGTTTTGCAGTGGCTACAGGTGACTGCGTCATCGGGCCCTGATATCGACGAA
CTGGCTCGCGAGCTGCAACAGAGCGCTGACCGAGGCGACATTATTGCCCATGGCTGGCTTCACACCCGCTCATCA
ATAAAGCTTCGGAAAAGCGTGACGGCATGGCCTCATTTGCTGGATCGGCAGACTCGTGGCATTTTGAATTCCCAC
GTCAATGCGGATGGAGCGCCTCTAGTCACCCAGCTGGACCCAGACGCCGCTACCCGGCAGGAACGCAAACTTGAG
CCTCGAGACGAATTCTTTGAGCGCTCAATATGGCTGGGCTGCTTTGAGCATCTTCGCCGCGGCAGCAGCCTCAAG
ACGATTCGCGAATGGTGTCAAGAGCGAACCGAAATGTGGCGGGCCGTCTCTGCGTCGGGTGTGCTTCTTGCTGCC
GACGGCAAGGACTCCATGGCCGACGCGCCTCCCGAGTCACTGGTGCTGTGGCGACGCGTGTGCCTCAGTCTATCT
CGCAATATTGGCTCGGATAATTATGAGCGCGCAGTCTATGGTATTCTGTCTGGAGACATTTCCAGTGTGGAAAGC
GTGGCAAAGAGCTGGAATGACCACTTGTTTGCCAACTATAATGCCCTTGTTCGTGCGCGCATCGATTCCTTTATA
CTGGGTAGATGCTCGCCCGAAGCAGTCTCGACGCTGTCGCAGTCGTTTTCCTCCTTTGATCCTCAACAGCTCCAA
GGCGACGATGCAGGCTTTGCTAAGCGGCTGGTCAAAAGTCTAGAAAATCGAGAGGACACCAGACAAGAGGCAATG
CAGCCGTACAAGGCGTTACAGGCTGCACTCATTGCTGACGACACAGACGCCTACCTTCGCGCACAGGGCTCACTC
TTGGCTGAGGCGGCCCAAAATGACAGGCCCTTGGGCAATTTTAGCCCAAGTCCACTGTCCAAGCCAGCCGATTGC
AGCCGAGAAAAGTTGTTTGGCTCAGGGCAACACGAGGGCTTGAGGGTTGTCACTCACGTCCATGTTCTCCTGACC
CTAATGCGATGCTTGGATGCTTCGGAAGGTAAGACACTGTCATTGGGCTCCGGCTTTGAGACGGTGGGCCAGGAG
CAAGTCATTGCCGCGTACACGGACTACTTGCAAAACTCGGGGCTCGAAGCTCTCATCCCACTCTACTGTTCCATC
CTCAAGCCACCTATGCAGTACGAAGTCCTTGGCAACAACATGATCAAGGAAGGAGACGCAGAAACACGCCTTCTT
CAGCTCCGGCTCATGAGAAAAGTTGGCATTGACTCTCTACAATTCACCGAGACGCTGGCCAGGCTTGTTCTCGAC
CAGCTTGTATTGACGGCAAAGGTGACATTTCCCTCGAATCCCATTTGCATACTGGCAGAGGGCCCGCCTAGCGCA
CGGTATGGACGAGCCATCTTGCCCGACTTTTTGGTCCGCAGCGGCAAGGAGATGACGGTCAAGGACGAGCACGTT
ATTCGTTCGCTCGAGTGGCTGCTCCAAGTCCAGGCTGCCTGGCCTGAAGTGGCTCGTATTGGAGAACAAGCATAC
AAGTTCTTTTTCACAAACAGGTGCCTTGTGGCAGTCAGCAACCTGGTGAAGCGCATCAAGTTTAGTAGTTTAATT
GGAAACATGATGGATGATGCTGAGGCGCTTCCCGATACAAACATGTTGGAAGACGTTGAATTCGTGCGGGAGAAG
CTGCAGCATATTGGCGCCTCGGGCGCCTCTGCAGAGCAAGTCAAGGTGAACCTGCGAAATTTTCACGACTTTGAG
GCTTTGGCCGCAGCGCTCGACGGCCTTGAGACAATCAGCTCTGCAATGCAGCTGCAGTTGATAGAACCACCTGAA
AATCAAAAGGACATCTTGAGGATAGCTGCAAACGAGGGCCCCGACTTGAAAACCAGTATGCAACCATTGATGCAT
AGCTGGGGAGTAGCAAGCATGCAAGCGGGCGACAAGGAGTTGGGAGATATTCGGCAGGCCTACCTGCCCGAGGTG
ATTTTGGCATTTGTGAGTGCGCTGCACTTTATGGGCAATAACCTCTCGCGAGACCACTTGCTGGAAGCCATGGAT
TTAGCAGCCCTGGTGGCAGAGCGAGAGTCGGACGTGGCGCAAGTTTTTATTAAGAGCAAGCGCATGACGGAGCTT
GTTGAGTCGTTTGCCGCATGTAGCAAAGCGCTGGCAGTGGTGACGGGAGAGAAGAGGGCGGCAGGATCAAGCAGC
AAGAAGCTGCGCGAGATGGGCTGGTCGCGCGATATCTGGGTTGTCAAGAATTAA
Gene >OphauB2|528
ATGTCGCTCACGGTTAACCAAGACATGGAGGATGACAATGTGGAAGAAGTAAAGCCAGAAGTCGAGACAAGGCCG
GGGCCTCACGTCGAAGAATTTGCCAATTATGTCGATCTCTGCATCGCCCCAAGCCTGAGTGTGTCGGAAAGGAAA
GCGCGGGTGCTGGAACTTCCTCGCAAGTTTCACGACAATGCAAATCGTCGGCTACTCCAAAAGAAACACAGGCGC
GTGGCCGACGGTAGCGGAGACATTGATATGGACTCGGAGAGATGGTCTCCTAGCTTCACTGCGGAAGAGCTCGAG
GAAGTTGACCAACTTGAAAAAGAAGTTCAGACGTGGGACCTTGTTCGCCGGCTGCTGCCGCTGAGGTTTGCCAAG
TCGCGAGCTGGGGCTCCTCGCTTGTCCTTGGAAGCCTCGAAGCATCCGACTCTGCGCGACTTGGCTGAGACTGAC
CCCATTCTCAAGGAACGCCGTGCTGTTTTGCAGTGGCTACAGGTGACTGCGTCATCGGGCCCTGATATCGACGAA
CTGGCTCGCGAGCTGCAACAGAGCGCTGACCGAGGCGACATTATTGCCCATGGCTGGCTTCACACCCGCTCATCA
ATAAAGCTTCGGAAAAGCGTGACGGCATGGCCTCATTTGCTGGATCGGCAGACTCGTGGCATTTTGAATTCCCAC
GTCAATGCGGATGGAGCGCCTCTAGTCACCCAGCTGGACCCAGACGCCGCTACCCGGCAGGAACGCAAACTTGAG
CCTCGAGACGAATTCTTTGAGCGCTCAATATGGCTGGGCTGCTTTGAGCATCTTCGCCGCGGCAGCAGCCTCAAG
ACGATTCGCGAATGGTGTCAAGAGCGAACCGAAATGTGGCGGGCCGTCTCTGCGTCGGGTGTGCTTCTTGCTGCC
GACGGCAAGGACTCCATGGCCGACGCGCCTCCCGAGTCACTGGTGCTGTGGCGACGCGTGTGCCTCAGTCTATCT
CGCAATATTGGCTCGGATAATTATGAGCGCGCAGTCTATGGTATTCTGTCTGGAGACATTTCCAGTGTGGAAAGC
GTGGCAAAGAGCTGGAATGACCACTTGTTTGCCAACTATAATGCCCTTGTTCGTGCGCGCATCGATTCCTTTATA
CTGGGTAGATGCTCGCCCGAAGCAGTCTCGACGCTGTCGCAGTCGTTTTCCTCCTTTGATCCTCAACAGCTCCAA
GGCGACGATGCAGGCTTTGCTAAGCGGCTGGTCAAAAGTCTAGAAAATCGAGAGGACACCAGACAAGAGGCAATG
CAGCCGTACAAGGCGTTACAGGCTGCACTCATTGCTGACGACACAGACGCCTACCTTCGCGCACAGGGCTCACTC
TTGGCTGAGGCGGCCCAAAATGACAGGCCCTTGGGCAATTTTAGCCCAAGTCCACTGTCCAAGCCAGCCGATTGC
AGCCGAGAAAAGTTGTTTGGCTCAGGGCAACACGAGGGCTTGAGGGTTGTCACTCACGTCCATGTTCTCCTGACC
CTAATGCGATGCTTGGATGCTTCGGAAGGTAAGACACTGTCATTGGGCTCCGGCTTTGAGACGGTGGGCCAGGAG
CAAGTCATTGCCGCGTACACGGACTACTTGCAAAACTCGGGGCTCGAAGCTCTCATCCCACTCTACTGTTCCATC
CTCAAGCCACCTATGCAGTACGAAGTCCTTGGCAACAACATGATCAAGGAAGGAGACGCAGAAACACGCCTTCTT
CAGCTCCGGCTCATGAGAAAAGTTGGCATTGACTCTCTACAATTCACCGAGACGCTGGCCAGGCTTGTTCTCGAC
CAGCTTGTATTGACGGCAAAGGTGACATTTCCCTCGAATCCCATTTGCATACTGGCAGAGGGCCCGCCTAGCGCA
CGGTATGGACGAGCCATCTTGCCCGACTTTTTGGTCCGCAGCGGCAAGGAGATGACGGTCAAGGACGAGCACGTT
ATTCGTTCGCTCGAGTGGCTGCTCCAAGTCCAGGCTGCCTGGCCTGAAGTGGCTCGTATTGGAGAACAAGCATAC
AAGTTCTTTTTCAGTGAGTGGACTCATCAAGTGTGACGACAGTATTTGCCGTGCTGATTTTTTCTCTTTTTTTTT
TTTTTTTTGCCAACAGCAAACAGGTGCCTTGTGGCAGTCAGCAACCTGGTGAAGCGCATCAAGTTTAGTAGTTTA
ATTGGAAACATGATGGATGATGCTGAGGCGCTTCCCGATACAAACATGTTGGAAGACGTTGAATTCGTGCGGGAG
AAGCTGCAGCATATTGGCGCCTCGGGCGCCTCTGCAGAGCAAGTCAAGGTGAACCTGCGAAATTTTCACGACTTT
GAGGCTTTGGCCGCAGCGCTCGACGGCCTTGAGACAATCAGCTCTGCAATGCAGCTGCAGTTGATGTGTGTGCAA
TGCATTCATGCTCATGGAACAAGTGAGAGACAGGAGCTGACAAAATGAGGTGCAGAGAACCACCTGAAAATCAAA
AGGACATCTTGAGGATAGCTGCAAACGAGGGCCCCGACTTGAAAACCAGTATGCAACCATTGATGCATAGCTGGG
GAGTAGCAAGCATGCAAGGTATGTCTTGTCGAGGCCACAACTTGTGAGATGCATTTACTGACGAGGAGAGCAGCG
GGCGACAAGGAGTTGGGAGATATTCGGCAGGCCTACCTGCCCGAGGTGATTTTGGCATTTGTGAGTGCGCTGCAC
TTTATGGGCAATAACCTCTCGCGAGACCACTTGCTGGAAGCCATGGATTTAGCAGCCCTGGTGGCAGAGCGAGAG
TCGGACGTGGCGCAAGTTTTTATTAAGAGCAAGCGCATGACGGAGCTTGTTGAGTCGTTTGCCGCATGTAGCAAA
GCGCTGGCAGTGGTGACGGGAGAGAAGAGGGCGGCAGGATCAAGCAGCAAGAAGCTGCGCGAGATGGGCTGGTCG
CGCGATATCTGGGTTGTCAAGAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail