Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5274
Gene name
LocationContig_4:206077..207619
Strand+
Gene length (bp)1542
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 5.6E-05 61 77
PF00098 zf-CCHC Zinc knuckle 5.4E-04 211 226
PF00098 zf-CCHC Zinc knuckle 2.3E-03 237 253
PF00098 zf-CCHC Zinc knuckle 4.0E-05 260 276
PF00098 zf-CCHC Zinc knuckle 4.4E-06 284 300
PF00098 zf-CCHC Zinc knuckle 1.4E-07 305 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 211 325 4.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 198 349 8.0E-15
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 198 349 8.0E-15
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 198 349 8.0E-15
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 198 349 9.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 211 325 4.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 198 349 8.0E-15
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 198 349 8.0E-15
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 198 349 8.0E-15
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 198 349 9.0E-15
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 203 349 1.0E-14
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 209 344 2.0E-14
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 203 349 4.0E-14
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 211 321 6.0E-14
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 248 372 2.0E-12
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 211 343 4.0E-12
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 170 301 1.0E-11
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 211 363 2.0E-11
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 211 320 8.0E-11
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 211 319 8.0E-11
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 261 343 7.0E-10
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 237 323 6.0E-09
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 233 319 2.0E-08
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 207 320 2.0E-08
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 204 302 2.0E-08
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 285 346 3.0E-08
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 261 343 7.0E-08
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 210 320 8.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 211 299 1.0E-07
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 198 323 6.0E-07
sp|P40507|AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR1 PE=1 SV=1 261 343 7.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 210 301 8.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 211 299 1.0E-06
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 261 320 3.0E-06
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 255 343 7.0E-06
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 260 338 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4628
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3603
Ophiocordyceps australis map64 (Brazil) OphauB2|5274 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02090
Ophiocordyceps camponoti-rufipedis Ophun1|2534
Ophiocordyceps kimflemingae Ophio5|512
Ophiocordyceps subramaniannii Hirsu2|9716

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5274
MDNTWGEIDNTWGEMDNTGGAGDAWGSGPADIIPSYTAVTPGDDGGGEKLPEKPVARVSLKCYGCGQIGHRAVEC
TNPRLVNRDHVADMSPDEAWAKLRSAVAERDVDDVKEAINEYVKAVNADITFRELQEALLDNGIKLFLIATEKPL
MKVLTNMDLQGNLGKKYSISYRFSEYADRPREVESFPKTREELLARLDDAGDIVNKGVPLCRNCDELGHISKYCP
KEKVIFERPKIICSNCNLEGHRIRDCKEPRKDKFACRNCGKSGHKAADCDEPPNLNNVQCRKCDEYGHFAKDCPK
ASAIVCRNCDQEGHMSRDCPQPRDWSKVQCSNCQLFGHTRVRCKAPVAAPSDEFGSGDFGSKNNSAEADNGFPAA
PDDVPAAQTHVERAWGPETGGGWEGGW*
Coding >OphauB2|5274
ATGGACAACACTTGGGGAGAAATTGACAACACTTGGGGAGAAATGGACAACACTGGGGGAGCTGGTGATGCCTGG
GGCTCAGGCCCAGCAGACATAATTCCGTCTTATACCGCAGTTACTCCAGGTGACGATGGCGGAGGAGAAAAGCTT
CCGGAGAAGCCTGTGGCCAGGGTCAGTCTGAAATGCTACGGATGCGGCCAAATTGGCCATCGTGCCGTGGAGTGC
ACCAATCCACGCCTTGTTAATCGGGATCATGTCGCCGACATGAGTCCCGACGAGGCATGGGCGAAACTTAGAAGT
GCAGTTGCTGAGCGCGATGTGGACGATGTGAAGGAGGCCATCAATGAATATGTCAAGGCCGTCAATGCAGACATC
ACGTTCCGCGAGCTTCAAGAGGCCCTGCTCGACAACGGCATCAAACTCTTCCTCATTGCCACTGAGAAGCCTCTC
ATGAAGGTTCTCACTAATATGGATCTCCAAGGCAACCTTGGAAAGAAGTATAGCATCTCTTACCGCTTTTCGGAG
TATGCCGATCGTCCTCGAGAGGTCGAAAGCTTCCCCAAGACTCGCGAAGAGCTTTTGGCTCGTTTGGATGACGCT
GGCGACATCGTCAATAAGGGAGTGCCCCTTTGCCGCAACTGCGATGAACTAGGACACATCTCAAAGTATTGTCCC
AAGGAGAAGGTTATATTTGAACGCCCCAAGATCATCTGCAGCAACTGTAACCTTGAGGGACACCGCATTCGTGAT
TGCAAGGAGCCACGCAAGGATAAATTCGCTTGCAGAAACTGCGGAAAATCCGGGCACAAGGCAGCGGATTGCGAC
GAGCCGCCCAATCTGAACAATGTACAGTGTCGAAAGTGCGACGAGTACGGACACTTTGCCAAAGACTGCCCCAAG
GCCAGTGCCATTGTTTGTCGCAATTGTGACCAGGAAGGACACATGAGCCGTGATTGTCCTCAGCCCAGGGACTGG
TCCAAGGTTCAATGTAGCAATTGCCAGCTCTTCGGGCACACCAGAGTGAGGTGCAAGGCCCCCGTGGCTGCTCCC
TCTGATGAATTTGGTAGCGGAGACTTTGGCAGCAAGAATAACAGCGCTGAGGCTGACAATGGGTTTCCTGCTGCT
CCTGATGATGTTCCCGCTGCTCAAACTCATGTTGAGCGTGCTTGGGGCCCTGAAACTGGTGGTGGCTGGGAGGGA
GGTTGGTAA
Transcript >OphauB2|5274
ATGGACAACACTTGGGGAGAAATTGACAACACTTGGGGAGAAATGGACAACACTGGGGGAGCTGGTGATGCCTGG
GGCTCAGGCCCAGCAGACATAATTCCGTCTTATACCGCAGTTACTCCAGGTGACGATGGCGGAGGAGAAAAGCTT
CCGGAGAAGCCTGTGGCCAGGGTCAGTCTGAAATGCTACGGATGCGGCCAAATTGGCCATCGTGCCGTGGAGTGC
ACCAATCCACGCCTTGTTAATCGGGATCATGTCGCCGACATGAGTCCCGACGAGGCATGGGCGAAACTTAGAAGT
GCAGTTGCTGAGCGCGATGTGGACGATGTGAAGGAGGCCATCAATGAATATGTCAAGGCCGTCAATGCAGACATC
ACGTTCCGCGAGCTTCAAGAGGCCCTGCTCGACAACGGCATCAAACTCTTCCTCATTGCCACTGAGAAGCCTCTC
ATGAAGGTTCTCACTAATATGGATCTCCAAGGCAACCTTGGAAAGAAGTATAGCATCTCTTACCGCTTTTCGGAG
TATGCCGATCGTCCTCGAGAGGTCGAAAGCTTCCCCAAGACTCGCGAAGAGCTTTTGGCTCGTTTGGATGACGCT
GGCGACATCGTCAATAAGGGAGTGCCCCTTTGCCGCAACTGCGATGAACTAGGACACATCTCAAAGTATTGTCCC
AAGGAGAAGGTTATATTTGAACGCCCCAAGATCATCTGCAGCAACTGTAACCTTGAGGGACACCGCATTCGTGAT
TGCAAGGAGCCACGCAAGGATAAATTCGCTTGCAGAAACTGCGGAAAATCCGGGCACAAGGCAGCGGATTGCGAC
GAGCCGCCCAATCTGAACAATGTACAGTGTCGAAAGTGCGACGAGTACGGACACTTTGCCAAAGACTGCCCCAAG
GCCAGTGCCATTGTTTGTCGCAATTGTGACCAGGAAGGACACATGAGCCGTGATTGTCCTCAGCCCAGGGACTGG
TCCAAGGTTCAATGTAGCAATTGCCAGCTCTTCGGGCACACCAGAGTGAGGTGCAAGGCCCCCGTGGCTGCTCCC
TCTGATGAATTTGGTAGCGGAGACTTTGGCAGCAAGAATAACAGCGCTGAGGCTGACAATGGGTTTCCTGCTGCT
CCTGATGATGTTCCCGCTGCTCAAACTCATGTTGAGCGTGCTTGGGGCCCTGAAACTGGTGGTGGCTGGGAGGGA
GGTTGGTAA
Gene >OphauB2|5274
ATGGACAACACTTGGGGAGAAATTGACAACACTTGGGGAGAAATGGACAACACTGGGGGAGCTGGTGATGCCTGG
GGCTCAGGCCCAGCAGACATAATTCCGTCTTATACCGCAGTTACTCCAGGTGACGATGGCGGAGGGTGAGTTACA
CACGTTACCGCCTCATTCGTCGTAGGATTATTATTGACCACTTCTTTTAGAGAAAAGCTTCCGGAGAAGCCTGTG
GCCAGGGTCAGTCTGAAATGCTACGGATGCGGCCAAATTGGGTAAGCTCACACTTTGTTTAAGCATTCAATGGCC
TTGCTGACAGGCCTTTAGCCATCGTGCCGTGGAGTGCACCAATCCACGCCTTGTTAATCGGGATCATGTCGCCGA
CATGAGTCCCGACGAGGCATGGGCGAAACTTAGAAGTGCAGTTGCTGAGCGCGATGTGGACGATGTGAAGGAGGC
CATCAATGAATATGTCAAGGCCGTCAATGCAGACATCACGTTCCGCGAGCTTCAAGAGGCCCTGCTCGACAACGG
CATCAAACTCTTCCTCATTGCCACTGAGAAGCCTCTCATGAAGGTTCTCACTAATATGGATCTCCAAGGCAACCT
TGGAAAGAAGTATAGCATCTCTTACCGCTTTTCGGAGTATGCCGATCGTCCTCGAGAGGTCGAAAGCTTCCCCAA
GACTCGCGAAGAGCTTTTGGCTCGTTTGGATGACGCTGGCGACATCGTCAATAAGGGAGTGCCCCTTTGCCGCAA
CTGCGATGAACTAGGACACATCTCAAAGTATTGTCCCAAGGAGAAGGTTATATTTGAACGCCCCAAGATCATCTG
CAGCAACTGTAACCTTGAGGGACACCGCATTCGTGATTGTAAGATATATTGATTCAAGTCTTAACGATGAGGCAA
TGCTAATCTGTTCAACAGGCAAGGAGCCACGCAAGGATAAATTCGCTTGCAGAAACTGCGGGTGAGTCTGCTGCA
TTGCAGTTTTGGCCGACCTGTTCATCGCTTACTGGAGTACAGAAAATCCGGGCACAAGGCAGCGGATTGCGACGA
GCCGCCCAATCTGAACAATGTACAGTGTCGAAAGTGCGACGAGTGTAAGTTTGCTTGCTGACACCGTACGACAAT
GGCTATATGCTAATTATGGTTTTGCTAGACGGACACTTTGCCAAAGACTGCCCCAAGGCCAGTGCCATTGTTTGT
CGCAATTGTGACCAGGAAGGACACATGAGCCGTGATTGTCCTCAGCCCAGGGACTGTGAGTAGCCTGCCAAGATT
GAACTCATTTACTATTGCTAACAGGAAGCAGGGTCCAAGGTTCAATGTAGCAATTGCCAGCTCTTCGGGCACACC
AGAGTGAGGTGCAAGGCCCCCGTGGCTGCTCCCTCTGATGAATTTGGTAGCGGAGACTTTGGCAGCAAGAATAAC
AGCGCTGAGGCTGACAATGGGTTTCCTGCTGCTCCTGATGATGTTCCCGCTGCTCAAACTCATGTTGAGCGTGCT
TGGGGCCCTGAAACTGGTGGTGGCTGGGAGGGAGGTTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail