Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5268
Gene name
LocationContig_4:179022..180644
Strand+
Gene length (bp)1622
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38966|YD089_YEAST Uncharacterized protein YDR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR089W PE=1 SV=2 1 148 6.0E-07
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 1 151 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 367 389 22
2 404 423 19
3 435 457 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5268
MKYGQQLVHQSVPEWSLHNLDYNSLKHEIKAHTTREQATAMPIPGHQDVLSSKFEDKLYMELVSQHDRVDLFVMS
KADEISRRLEHLNSSMQKWISRYQDGIGSPISLRRQRRFAKYERVLLRCRDDIVALSRFASAQVTAIRKILKKYR
KWTGSTTLSSRFNQNILGNPKSFTRRDFGPLHARHDDILAELRAAAPRFSGPSSPSLSNDSTVDDLAEPLTPRRT
RVSFDPLPPVQIYSPPQGKYWNEYDDGSDTGGADDEYAIYIDPEHGSSFPGLAYARAMVTLPYQKARQWLGKRRP
ASMSSDSTDSQHAQRPLLAANHHPAGYSSTAMDAQQDSPADVYAASAHDAMPSLSLRRMERYRERALAWGTGGSF
VASFLLLGIASILMATGKRRLRVEVDAGVTVGVVASLFCACMGLGMTLYRRDKLTLPYRLSICSSFVMSCLLNGM
LLILVLGNTP*
Coding >OphauB2|5268
ATGAAGTACGGCCAGCAGCTCGTGCACCAATCGGTGCCCGAATGGAGTCTGCACAATCTCGACTACAACTCGCTC
AAGCACGAAATCAAGGCGCATACGACGCGGGAGCAGGCCACGGCAATGCCCATTCCCGGACACCAAGATGTCTTG
TCGAGCAAGTTTGAAGACAAGTTGTATATGGAGCTCGTCAGCCAGCACGACCGCGTGGATCTTTTTGTCATGAGC
AAGGCGGATGAAATCTCGAGACGACTTGAGCATCTCAACTCGAGCATGCAGAAATGGATAAGCCGATATCAAGAC
GGCATCGGCTCTCCCATATCGCTGCGGCGGCAGCGGCGCTTTGCCAAGTATGAGCGAGTGCTGCTGCGCTGCCGC
GACGACATTGTTGCGCTGTCGCGCTTTGCCAGCGCGCAAGTGACTGCCATTCGCAAGATTTTGAAGAAATACCGG
AAATGGACGGGCTCGACGACGCTCTCGTCGCGCTTCAACCAAAACATACTCGGCAACCCCAAGAGCTTTACCCGG
CGCGACTTTGGCCCGCTGCATGCTCGCCACGACGACATTCTTGCCGAGCTGCGAGCGGCCGCTCCTCGCTTCAGC
GGCCCCAGCTCGCCATCGCTGTCCAACGACTCGACCGTGGACGACTTGGCAGAGCCGCTGACGCCCCGCCGCACG
CGCGTCAGCTTTGATCCGCTGCCGCCCGTGCAGATTTACTCGCCGCCCCAGGGCAAGTACTGGAACGAGTATGAC
GACGGCAGCGACACGGGCGGCGCCGACGACGAGTATGCCATTTACATTGACCCCGAGCACGGATCCAGCTTCCCT
GGGCTGGCCTATGCGCGCGCCATGGTGACGCTGCCCTACCAAAAGGCCCGCCAGTGGCTGGGCAAGCGCCGGCCA
GCTAGCATGTCCAGCGACAGCACGGACAGCCAGCATGCCCAGCGCCCGCTCCTGGCAGCCAACCACCACCCTGCC
GGCTACTCGTCCACAGCCATGGACGCGCAGCAAGACTCGCCAGCCGACGTCTACGCTGCCAGTGCCCATGACGCC
ATGCCCTCTCTCTCGCTGCGCCGCATGGAGCGCTATCGCGAGCGTGCCCTCGCTTGGGGCACCGGCGGCTCCTTT
GTCGCCTCGTTTCTCCTGCTCGGCATTGCCAGCATCCTCATGGCCACGGGCAAGCGCCGCCTCCGCGTCGAGGTG
GACGCCGGCGTCACTGTGGGCGTCGTGGCCAGTCTGTTTTGCGCCTGCATGGGGCTGGGCATGACGCTCTACCGC
CGCGACAAGCTGACTCTGCCCTACCGCTTGTCCATTTGCTCCTCCTTTGTCATGTCGTGTCTACTCAATGGCATG
CTACTCATTCTGGTGCTGGGCAACACGCCATGA
Transcript >OphauB2|5268
ATGAAGTACGGCCAGCAGCTCGTGCACCAATCGGTGCCCGAATGGAGTCTGCACAATCTCGACTACAACTCGCTC
AAGCACGAAATCAAGGCGCATACGACGCGGGAGCAGGCCACGGCAATGCCCATTCCCGGACACCAAGATGTCTTG
TCGAGCAAGTTTGAAGACAAGTTGTATATGGAGCTCGTCAGCCAGCACGACCGCGTGGATCTTTTTGTCATGAGC
AAGGCGGATGAAATCTCGAGACGACTTGAGCATCTCAACTCGAGCATGCAGAAATGGATAAGCCGATATCAAGAC
GGCATCGGCTCTCCCATATCGCTGCGGCGGCAGCGGCGCTTTGCCAAGTATGAGCGAGTGCTGCTGCGCTGCCGC
GACGACATTGTTGCGCTGTCGCGCTTTGCCAGCGCGCAAGTGACTGCCATTCGCAAGATTTTGAAGAAATACCGG
AAATGGACGGGCTCGACGACGCTCTCGTCGCGCTTCAACCAAAACATACTCGGCAACCCCAAGAGCTTTACCCGG
CGCGACTTTGGCCCGCTGCATGCTCGCCACGACGACATTCTTGCCGAGCTGCGAGCGGCCGCTCCTCGCTTCAGC
GGCCCCAGCTCGCCATCGCTGTCCAACGACTCGACCGTGGACGACTTGGCAGAGCCGCTGACGCCCCGCCGCACG
CGCGTCAGCTTTGATCCGCTGCCGCCCGTGCAGATTTACTCGCCGCCCCAGGGCAAGTACTGGAACGAGTATGAC
GACGGCAGCGACACGGGCGGCGCCGACGACGAGTATGCCATTTACATTGACCCCGAGCACGGATCCAGCTTCCCT
GGGCTGGCCTATGCGCGCGCCATGGTGACGCTGCCCTACCAAAAGGCCCGCCAGTGGCTGGGCAAGCGCCGGCCA
GCTAGCATGTCCAGCGACAGCACGGACAGCCAGCATGCCCAGCGCCCGCTCCTGGCAGCCAACCACCACCCTGCC
GGCTACTCGTCCACAGCCATGGACGCGCAGCAAGACTCGCCAGCCGACGTCTACGCTGCCAGTGCCCATGACGCC
ATGCCCTCTCTCTCGCTGCGCCGCATGGAGCGCTATCGCGAGCGTGCCCTCGCTTGGGGCACCGGCGGCTCCTTT
GTCGCCTCGTTTCTCCTGCTCGGCATTGCCAGCATCCTCATGGCCACGGGCAAGCGCCGCCTCCGCGTCGAGGTG
GACGCCGGCGTCACTGTGGGCGTCGTGGCCAGTCTGTTTTGCGCCTGCATGGGGCTGGGCATGACGCTCTACCGC
CGCGACAAGCTGACTCTGCCCTACCGCTTGTCCATTTGCTCCTCCTTTGTCATGTCGTGTCTACTCAATGGCATG
CTACTCATTCTGGTGCTGGGCAACACGCCATGA
Gene >OphauB2|5268
ATGAAGTACGGCCAGCAGCTCGTGCACCAATCGGTGCCCGAATGGAGTCTGCGTATGTTTTTGCTTGCTTGCTTG
CCTGCCCTAAAAAGAAGAAGAAAAAGGAAAAGGAAAAAAAAAAAAAGGCGGCGTTGGTTGTTGGGGCTGACAGTG
TTGGCAGACAATCTCGACTACAACTCGCTCAAGCACGAAATCAAGGCGCATACGACGCGGGAGCAGGCCACGGCA
ATGCCCATTCCCGGACACCAAGATGTCTTGTCGAGCAAGTTTGAAGACAAGTTGTATATGGAGCTCGTCAGCCAG
CACGACCGCGTGGATCTTTTTGTCATGAGCAAGGCGGATGAAATCTCGAGACGACTTGGTGCGGCGCGCCCTCCT
TGTCTGTCTGCTTCATGGAGTCGTTTGAATGCTGACTCGACGACGCAGAGCATCTCAACTCGAGCATGCAGAAAT
GGATAAGCCGATATCAAGACGGCATCGGCTCTCCCATATCGCTGCGGCGGCAGCGGCGCTTTGCCAAGTATGAGC
GAGTGCTGCTGCGCTGCCGCGACGACATTGTTGCGCTGTCGCGCTTTGCCAGCGCGCAAGTGACTGCCATTCGCA
AGATTTTGAAGAAATACCGGGTTTGTGTGCTTGCCCTCAAGACTGCCTCGACCCGGGCTAATACAAAGAGGGCCC
CCCCCCTTGGATAGAAATGGACGGGCTCGACGACGCTCTCGTCGCGCTTCAACCAAAACATACTCGGCAACCCCA
AGAGCTTTACCCGGCGCGACTTTGGCCCGCTGCATGCTCGCCACGACGACATTCTTGCCGAGCTGCGAGCGGCCG
CTCCTCGCTTCAGCGGCCCCAGCTCGCCATCGCTGTCCAACGACTCGACCGTGGACGACTTGGCAGAGCCGCTGA
CGCCCCGCCGCACGCGCGTCAGCTTTGATCCGCTGCCGCCCGTGCAGATTTACTCGCCGCCCCAGGGCAAGTACT
GGAACGAGTATGACGACGGCAGCGACACGGGCGGCGCCGACGACGAGTATGCCATTTACATTGACCCCGAGCACG
GATCCAGCTTCCCTGGGCTGGCCTATGCGCGCGCCATGGTGACGCTGCCCTACCAAAAGGCCCGCCAGTGGCTGG
GCAAGCGCCGGCCAGCTAGCATGTCCAGCGACAGCACGGACAGCCAGCATGCCCAGCGCCCGCTCCTGGCAGCCA
ACCACCACCCTGCCGGCTACTCGTCCACAGCCATGGACGCGCAGCAAGACTCGCCAGCCGACGTCTACGCTGCCA
GTGCCCATGACGCCATGCCCTCTCTCTCGCTGCGCCGCATGGAGCGCTATCGCGAGCGTGCCCTCGCTTGGGGCA
CCGGCGGCTCCTTTGTCGCCTCGTTTCTCCTGCTCGGCATTGCCAGCATCCTCATGGCCACGGGCAAGCGCCGCC
TCCGCGTCGAGGTGGACGCCGGCGTCACTGTGGGCGTCGTGGCCAGTCTGTTTTGCGCCTGCATGGGGCTGGGCA
TGACGCTCTACCGCCGCGACAAGCTGACTCTGCCCTACCGCTTGTCCATTTGCTCCTCCTTTGTCATGTCGTGTC
TACTCAATGGCATGCTACTCATTCTGGTGCTGGGCAACACGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail