Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5267
Gene name
LocationContig_4:173906..175373
Strand+
Gene length (bp)1467
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01380 SIS SIS domain 1.9E-11 148 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Z4C7|GUTQ_SALTI Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhi GN=gutQ PE=3 SV=1 147 310 3.0E-25
sp|O67500|Y1546_AQUAE Uncharacterized phosphosugar isomerase aq_1546 OS=Aquifex aeolicus (strain VF5) GN=aq_1546 PE=3 SV=1 130 309 4.0E-25
sp|Q8ZMJ9|GUTQ_SALTY Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gutQ PE=3 SV=2 147 310 5.0E-25
sp|P17115|GUTQ_ECOLI Arabinose 5-phosphate isomerase GutQ OS=Escherichia coli (strain K12) GN=gutQ PE=1 SV=3 147 310 1.0E-24
sp|Q8X4S5|GUTQ_ECO57 Arabinose 5-phosphate isomerase GutQ OS=Escherichia coli O157:H7 GN=gutQ PE=3 SV=3 147 310 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Z4C7|GUTQ_SALTI Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhi GN=gutQ PE=3 SV=1 147 310 3.0E-25
sp|O67500|Y1546_AQUAE Uncharacterized phosphosugar isomerase aq_1546 OS=Aquifex aeolicus (strain VF5) GN=aq_1546 PE=3 SV=1 130 309 4.0E-25
sp|Q8ZMJ9|GUTQ_SALTY Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gutQ PE=3 SV=2 147 310 5.0E-25
sp|P17115|GUTQ_ECOLI Arabinose 5-phosphate isomerase GutQ OS=Escherichia coli (strain K12) GN=gutQ PE=1 SV=3 147 310 1.0E-24
sp|Q8X4S5|GUTQ_ECO57 Arabinose 5-phosphate isomerase GutQ OS=Escherichia coli O157:H7 GN=gutQ PE=3 SV=3 147 310 1.0E-24
sp|Q83MK2|GUTQ_SHIFL Arabinose 5-phosphate isomerase GutQ OS=Shigella flexneri GN=gutQ PE=3 SV=5 147 310 1.0E-24
sp|Q8FEN7|GUTQ_ECOL6 Arabinose 5-phosphate isomerase GutQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gutQ PE=3 SV=1 147 310 2.0E-24
sp|P45313|API_HAEIN Probable arabinose 5-phosphate isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1678 PE=3 SV=1 97 309 1.0E-22
sp|Q8Z3G6|KDSD_SALTI Arabinose 5-phosphate isomerase KdsD OS=Salmonella typhi GN=kdsD PE=3 SV=1 104 309 3.0E-22
sp|Q8ZLS1|KDSD_SALTY Arabinose 5-phosphate isomerase KdsD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdsD PE=3 SV=1 104 309 3.0E-22
sp|Q83JF4|KDSD_SHIFL Arabinose 5-phosphate isomerase KdsD OS=Shigella flexneri GN=kdsD PE=3 SV=2 104 309 3.0E-22
sp|Q8X9J0|KDSD_ECO57 Arabinose 5-phosphate isomerase KdsD OS=Escherichia coli O157:H7 GN=kdsD PE=3 SV=1 104 309 9.0E-22
sp|P45395|KDSD_ECOLI Arabinose 5-phosphate isomerase KdsD OS=Escherichia coli (strain K12) GN=kdsD PE=1 SV=1 104 309 1.0E-21
sp|Q47334|KPSF5_ECOLX Arabinose 5-phosphate isomerase KpsF OS=Escherichia coli GN=kpsF PE=3 SV=1 108 309 3.0E-21
sp|P42502|KPSF1_ECOLX Arabinose 5-phosphate isomerase KpsF OS=Escherichia coli GN=kpsF PE=3 SV=1 147 309 3.0E-21
sp|Q8FD73|KDSD_ECOL6 Arabinose 5-phosphate isomerase KdsD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdsD PE=3 SV=2 104 309 4.0E-21
sp|Q8FDQ2|KPSF_ECOL6 Arabinose 5-phosphate isomerase KpsF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kpsF PE=1 SV=2 108 309 4.0E-21
sp|Q8D1Q8|KDSD_YERPE Arabinose 5-phosphate isomerase KdsD OS=Yersinia pestis GN=kdsD PE=3 SV=2 104 309 7.0E-21
sp|Q9HVW0|KDSD_PSEAE Arabinose 5-phosphate isomerase KdsD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdsD PE=1 SV=1 127 309 1.0E-20
sp|Q5NGP7|KDSD_FRATT Arabinose 5-phosphate isomerase KdsD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=kdsD PE=1 SV=1 130 309 1.0E-19
sp|Q9ZD42|Y505_RICPR Uncharacterized protein RP505 OS=Rickettsia prowazekii (strain Madrid E) GN=RP505 PE=3 SV=1 107 313 6.0E-19
sp|Q9ZJI5|YE29_HELPJ Uncharacterized protein jhp_1324 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_1324 PE=3 SV=1 105 224 3.0E-17
sp|O25971|Y1429_HELPY Uncharacterized protein HP_1429 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1429 PE=3 SV=1 107 312 1.0E-16
sp|Q9Z826|Y526_CHLPN Uncharacterized protein CPn_0526/CP_0226/CPj0526/CpB0547 OS=Chlamydia pneumoniae GN=CPn_0526 PE=3 SV=1 135 309 1.0E-15
sp|Q9PJZ7|Y679_CHLMU Uncharacterized protein TC_0679 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0679 PE=3 SV=1 147 309 3.0E-15
sp|O84404|Y399_CHLTR Uncharacterized protein CT_399 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_399 PE=3 SV=1 147 309 9.0E-13
sp|Q9M1T1|SETH3_ARATH Probable arabinose 5-phosphate isomerase OS=Arabidopsis thaliana GN=SETH3 PE=2 SV=1 147 312 8.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0097367 carbohydrate derivative binding Yes
GO:1901135 carbohydrate derivative metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5267
MADRRQNDHRPIQTSAVIVLGTLKPPEKPPPSPPTPAILPYDGTLCQPSEAFSLGAEQQPASSPLSPTLSSSSSQ
EQEPSANDAAAVSRVLDEDETRRRRLERGLHVLATEARALASLAQLYETDGMARQGFNGAVNLLARTCAGGGKVV
VIGVGKSGHIGRKLVATLQSLGVGAALLHPTEALHGDLGLIGARDALLFITYSGRTPELQQLLPHLDECLPAIVL
TSHTRREDCELVQLLSTRRAQEQVVLLCAPIPEAELTSFGVAAPSTSTTTALALCDALAMTVAAELDSDVASRFA
RNHPGGAIGAAVAATSACESRAASMKHEEMQGQGGLLEHIAVPWQDMAQEHGLSHDSLGVDLLRAGYASKTGWVR
IQANGETAAVAAPGRIRQLSRSELGLPLRDVAHAVVAMQDVVVLAGDMSIHGAADVVRAMMRPSPEAQGGEAAAG
LEAACCGPEAVIAVAHGDSIVGLLEAGQLLERQEAAAQ*
Coding >OphauB2|5267
ATGGCGGACCGGCGGCAAAACGACCATCGGCCTATCCAGACGAGCGCCGTCATTGTGCTGGGCACCCTCAAGCCG
CCTGAAAAGCCACCGCCATCTCCGCCGACTCCGGCCATTCTACCGTACGACGGCACCCTATGCCAGCCAAGCGAA
GCCTTTAGCCTCGGAGCCGAGCAGCAGCCGGCTTCTTCGCCATTGTCGCCCACGCTGTCTTCTTCTTCGTCGCAG
GAACAAGAGCCGTCGGCCAACGACGCAGCCGCTGTGTCGCGTGTCTTGGATGAAGACGAGACGAGGCGGAGACGC
CTTGAGCGCGGACTCCATGTGCTTGCCACCGAGGCCCGGGCCCTGGCCAGCCTGGCGCAACTGTACGAGACAGAC
GGCATGGCGCGGCAGGGCTTCAATGGCGCCGTCAATCTACTGGCGCGCACCTGTGCCGGCGGCGGCAAGGTGGTC
GTTATTGGCGTGGGCAAGTCGGGCCATATTGGACGCAAGCTCGTGGCGACACTGCAGAGCCTGGGGGTAGGGGCG
GCGCTTCTGCACCCGACCGAGGCATTGCATGGCGACCTGGGGCTCATTGGCGCGCGCGACGCCCTGCTCTTCATC
ACCTACTCGGGACGGACTCCCGAGCTGCAGCAGCTGTTGCCGCATCTTGACGAGTGCTTGCCTGCCATTGTGCTC
ACCTCGCATACGCGCCGGGAGGACTGTGAGCTGGTGCAGTTGCTGTCGACACGACGGGCTCAAGAACAGGTGGTG
CTGCTATGCGCGCCCATCCCCGAGGCGGAGCTGACGTCGTTTGGCGTGGCGGCACCGTCGACATCGACAACGACA
GCCCTGGCGCTGTGCGATGCGCTTGCCATGACAGTTGCGGCCGAACTGGACTCGGATGTGGCATCGAGGTTTGCC
AGAAACCACCCCGGCGGGGCCATTGGTGCTGCCGTGGCGGCCACGAGCGCCTGCGAGTCAAGGGCGGCGTCAATG
AAGCATGAGGAAATGCAAGGGCAGGGCGGGCTCCTTGAGCACATTGCGGTGCCATGGCAAGACATGGCACAAGAG
CATGGCTTGAGTCACGACAGCCTGGGGGTGGATCTGCTGCGGGCGGGCTATGCGTCCAAGACGGGCTGGGTGAGG
ATCCAGGCAAACGGCGAGACCGCGGCCGTTGCGGCACCAGGGCGGATCCGACAGCTGTCTCGCAGCGAGCTCGGA
CTGCCGCTTCGAGACGTGGCCCATGCCGTGGTGGCCATGCAAGATGTAGTCGTCTTGGCAGGCGACATGTCCATC
CATGGGGCTGCAGACGTGGTGCGGGCCATGATGCGGCCGTCGCCCGAGGCCCAGGGCGGCGAGGCAGCAGCGGGG
CTGGAGGCGGCTTGCTGTGGCCCAGAAGCCGTCATTGCCGTGGCTCACGGCGATAGCATCGTCGGCCTGCTCGAG
GCTGGCCAGCTGCTGGAGCGCCAAGAGGCTGCGGCTCAATGA
Transcript >OphauB2|5267
ATGGCGGACCGGCGGCAAAACGACCATCGGCCTATCCAGACGAGCGCCGTCATTGTGCTGGGCACCCTCAAGCCG
CCTGAAAAGCCACCGCCATCTCCGCCGACTCCGGCCATTCTACCGTACGACGGCACCCTATGCCAGCCAAGCGAA
GCCTTTAGCCTCGGAGCCGAGCAGCAGCCGGCTTCTTCGCCATTGTCGCCCACGCTGTCTTCTTCTTCGTCGCAG
GAACAAGAGCCGTCGGCCAACGACGCAGCCGCTGTGTCGCGTGTCTTGGATGAAGACGAGACGAGGCGGAGACGC
CTTGAGCGCGGACTCCATGTGCTTGCCACCGAGGCCCGGGCCCTGGCCAGCCTGGCGCAACTGTACGAGACAGAC
GGCATGGCGCGGCAGGGCTTCAATGGCGCCGTCAATCTACTGGCGCGCACCTGTGCCGGCGGCGGCAAGGTGGTC
GTTATTGGCGTGGGCAAGTCGGGCCATATTGGACGCAAGCTCGTGGCGACACTGCAGAGCCTGGGGGTAGGGGCG
GCGCTTCTGCACCCGACCGAGGCATTGCATGGCGACCTGGGGCTCATTGGCGCGCGCGACGCCCTGCTCTTCATC
ACCTACTCGGGACGGACTCCCGAGCTGCAGCAGCTGTTGCCGCATCTTGACGAGTGCTTGCCTGCCATTGTGCTC
ACCTCGCATACGCGCCGGGAGGACTGTGAGCTGGTGCAGTTGCTGTCGACACGACGGGCTCAAGAACAGGTGGTG
CTGCTATGCGCGCCCATCCCCGAGGCGGAGCTGACGTCGTTTGGCGTGGCGGCACCGTCGACATCGACAACGACA
GCCCTGGCGCTGTGCGATGCGCTTGCCATGACAGTTGCGGCCGAACTGGACTCGGATGTGGCATCGAGGTTTGCC
AGAAACCACCCCGGCGGGGCCATTGGTGCTGCCGTGGCGGCCACGAGCGCCTGCGAGTCAAGGGCGGCGTCAATG
AAGCATGAGGAAATGCAAGGGCAGGGCGGGCTCCTTGAGCACATTGCGGTGCCATGGCAAGACATGGCACAAGAG
CATGGCTTGAGTCACGACAGCCTGGGGGTGGATCTGCTGCGGGCGGGCTATGCGTCCAAGACGGGCTGGGTGAGG
ATCCAGGCAAACGGCGAGACCGCGGCCGTTGCGGCACCAGGGCGGATCCGACAGCTGTCTCGCAGCGAGCTCGGA
CTGCCGCTTCGAGACGTGGCCCATGCCGTGGTGGCCATGCAAGATGTAGTCGTCTTGGCAGGCGACATGTCCATC
CATGGGGCTGCAGACGTGGTGCGGGCCATGATGCGGCCGTCGCCCGAGGCCCAGGGCGGCGAGGCAGCAGCGGGG
CTGGAGGCGGCTTGCTGTGGCCCAGAAGCCGTCATTGCCGTGGCTCACGGCGATAGCATCGTCGGCCTGCTCGAG
GCTGGCCAGCTGCTGGAGCGCCAAGAGGCTGCGGCTCAATGA
Gene >OphauB2|5267
ATGGCGGACCGGCGGCAAAACGACCATCGGCCTATCCAGACGAGCGCCGTCATTGTGCTGGGCACCCTCAAGCCG
CCTGAAAAGCCACCGCCATCTCCGCCGACTCCGGCCATTCTACCGTACGACGGCACCCTATGCCAGCCAAGCGAA
GCCTTTAGCCTCGGAGCCGAGCAGCAGCCGGCTTCTTCGCCATTGTCGCCCACGCTGTCTTCTTCTTCGTCGCAG
GAACAAGAGCCGTCGGCCAACGACGCAGCCGCTGTGTCGCGTGTCTTGGATGAAGACGAGACGAGGCGGAGACGC
CTTGAGCGCGGACTCCATGTGCTTGCCACCGAGGCCCGGGCCCTGGCCAGCCTGGCGCAACTGTACGAGACAGAC
GGCATGGCGCGGCAGGGCTTCAATGGCGCCGTCAATCTACTGGCGCGCACCTGTGCCGGCGGCGGCAAGGTGGTC
GTTATTGGCGTGGGCAAGTCGGGCCATATTGGACGCAAGCTCGTGGCGACACTGCAGAGCCTGGGGGTAGGGGCG
GCGCTTCTGCACCCGACCGAGGCATTGCATGGCGACCTGGGGCTCATTGGCGCGCGCGACGCCCTGCTCTTCATC
ACCTACTCGGGACGGACTCCCGAGCTGCAGCAGCTGTTGCCGCATCTTGACGAGTGCTTGCCTGCCATTGTGCTC
ACCTCGCATACGCGCCGGGAGGACTGTGAGCTGGTGCAGTTGCTGTCGACACGACGGGCTCAAGAACAGGTGGTG
CTGCTATGCGCGCCCATCCCCGAGGCGGAGCTGACGTCGTTTGGCGTGGCGGCACCGTCGACATCGACAACGACA
GCCCTGGCGCTGTGCGATGCGCTTGCCATGACAGTTGCGGCCGAACTGGACTCGGATGTGGCATCGAGGTTTGCC
AGAAACCACCCCGGCGGGGCCATTGGTGCTGCCGTGGCGGCCACGAGCGCCTGCGAGTCAAGGGCGGCGTCAATG
AAGCATGAGGAAATGCAAGGGCAGGGCGGGCTCCTTGAGCACATTGCGGTGCCATGGCAAGACATGGCACAAGAG
CATGGCTTGAGTCACGACAGCCTGGGGGTGGATCTGCTGCGGGCGGGCTATGCGTCCAAGACGGGCTGGGTGAGG
ATCCAGGCAAACGGCGAGACCGCGGCCGTTGCGGCACCAGGGCGGATCCGACAGCTGTCTCGCAGCGAGCTCGGA
CTGCCGCTTCGAGACGTGGCCCATGCCGTGGTGGCCATGCAAGATGTAGTCGTCTTGGCAGGCGACATGTCCATC
CATGGGGCTGCAGACGTGGTGCGGGCCATGATGCGGCCGTCGCCCGAGGCCCAGGGCGGCGAGGCAGCAGCGGGG
CTGGAGGCGGCTTGCTGTGGCCCAGAAGCCGTCATTGCCGTGGCTCACGGCGATAGCATCGTCGGCCTGCTCGAG
GCTGGCCAGCTGCTGGAGCGCCAAGAGGCTGCGGCTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail