Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5248
Gene name
LocationContig_4:128777..131381
Strand+
Gene length (bp)2604
Transcript length (bp)2541
Coding sequence length (bp)2541
Protein length (aa) 847

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09333 ATG_C Autophagy-related protein C terminal domain 6.9E-31 750 845
PF13329 ATG2_CAD Autophagy-related protein 2 CAD motif 5.9E-31 2 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QSC9|ATG2_ASPNC Autophagy-related protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg2 PE=3 SV=1 23 842 0.0E+00
sp|Q871L5|ATG2_NEUCR Autophagy-related protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-2 PE=3 SV=2 1 845 0.0E+00
sp|A6R6E3|ATG2_AJECN Autophagy-related protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG2 PE=3 SV=1 23 845 0.0E+00
sp|A7KAL3|ATG2_PENRW Autophagy-related protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg2 PE=3 SV=1 23 845 0.0E+00
sp|Q1E702|ATG2_COCIM Autophagy-related protein 2 OS=Coccidioides immitis (strain RS) GN=ATG2 PE=3 SV=1 23 845 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QSC9|ATG2_ASPNC Autophagy-related protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg2 PE=3 SV=1 23 842 0.0E+00
sp|Q871L5|ATG2_NEUCR Autophagy-related protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-2 PE=3 SV=2 1 845 0.0E+00
sp|A6R6E3|ATG2_AJECN Autophagy-related protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG2 PE=3 SV=1 23 845 0.0E+00
sp|A7KAL3|ATG2_PENRW Autophagy-related protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg2 PE=3 SV=1 23 845 0.0E+00
sp|Q1E702|ATG2_COCIM Autophagy-related protein 2 OS=Coccidioides immitis (strain RS) GN=ATG2 PE=3 SV=1 23 845 0.0E+00
sp|Q5B1T9|ATG2_EMENI Autophagy-related protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg2 PE=3 SV=2 24 845 0.0E+00
sp|A6S7C7|ATG2_BOTFB Autophagy-related protein 2 OS=Botryotinia fuckeliana (strain B05.10) GN=atg2 PE=3 SV=1 16 845 0.0E+00
sp|Q2ULE1|ATG2_ASPOR Autophagy-related protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg2 PE=3 SV=1 23 845 0.0E+00
sp|Q4WLK5|ATG2_ASPFU Autophagy-related protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg2 PE=3 SV=1 19 842 0.0E+00
sp|A1CUF9|ATG2_ASPCL Autophagy-related protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg2 PE=3 SV=1 18 845 0.0E+00
sp|Q0CSI0|ATG2_ASPTN Autophagy-related protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg2 PE=3 SV=1 23 845 0.0E+00
sp|A1DP40|ATG2_NEOFI Autophagy-related protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg2 PE=3 SV=1 19 845 0.0E+00
sp|Q51ZN8|ATG2_MAGO7 Autophagy-related protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG2 PE=3 SV=2 1 845 0.0E+00
sp|A7E6F5|ATG2_SCLS1 Autophagy-related protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg2 PE=3 SV=1 1 845 0.0E+00
sp|Q2GYD8|ATG2_CHAGB Autophagy-related protein 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG2 PE=3 SV=1 1 845 0.0E+00
sp|Q6C6M0|ATG2_YARLI Autophagy-related protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG2 PE=3 SV=2 81 845 2.0E-131
sp|P0CM30|ATG2_CRYNJ Autophagy-related protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG2 PE=3 SV=1 301 845 2.0E-115
sp|P0CM31|ATG2_CRYNB Autophagy-related protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG2 PE=3 SV=1 301 845 2.0E-115
sp|A7KAI1|ATG2_PICAN Autophagy-related protein 2 OS=Pichia angusta GN=ATG2 PE=3 SV=1 301 720 3.0E-109
sp|Q6BTX0|ATG2_DEBHA Autophagy-related protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG2 PE=3 SV=2 31 735 1.0E-105
sp|Q75E74|ATG2_ASHGO Autophagy-related protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG2 PE=3 SV=3 302 846 4.0E-94
sp|Q59X11|ATG2_CANAL Autophagy-related protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG2 PE=3 SV=1 289 725 6.0E-93
sp|A3LT28|ATG2_PICST Autophagy-related protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG2 PE=3 SV=2 301 725 2.0E-91
sp|Q6CQ43|ATG2_KLULA Autophagy-related protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG2 PE=3 SV=1 299 845 5.0E-90
sp|Q4PFE7|ATG2_USTMA Autophagy-related protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG2 PE=3 SV=1 297 845 4.0E-88
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 75 720 4.0E-88
sp|A7TM79|ATG2_VANPO Autophagy-related protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG2 PE=3 SV=1 299 845 6.0E-86
sp|P53855|ATG2_YEAST Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG2 PE=1 SV=1 311 845 2.0E-85
sp|A6ZRK1|ATG2_YEAS7 Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG2 PE=3 SV=1 311 845 4.0E-85
sp|O94649|ATG2_SCHPO Autophagy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg2 PE=1 SV=4 75 845 3.0E-71
sp|Q6FP05|ATG2_CANGA Autophagy-related protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG2 PE=3 SV=1 315 845 6.0E-64
sp|F8S296|ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana GN=ATG2 PE=2 SV=1 418 844 2.0E-43
sp|Q08D51|ATG2A_XENTR Autophagy-related protein 2 homolog A OS=Xenopus tropicalis GN=atg2a PE=2 SV=1 418 845 2.0E-35
sp|Q6P4T0|ATG2A_MOUSE Autophagy-related protein 2 homolog A OS=Mus musculus GN=Atg2a PE=1 SV=2 418 845 2.0E-33
sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 418 845 6.0E-32
sp|Q80XK6|ATG2B_MOUSE Autophagy-related protein 2 homolog B OS=Mus musculus GN=Atg2b PE=1 SV=3 557 846 8.0E-29
sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5 573 846 1.0E-27
sp|A7KAI1|ATG2_PICAN Autophagy-related protein 2 OS=Pichia angusta GN=ATG2 PE=3 SV=1 741 846 2.0E-19
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 734 846 1.0E-16
sp|A3LT28|ATG2_PICST Autophagy-related protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG2 PE=3 SV=2 722 846 2.0E-12
sp|Q6BTX0|ATG2_DEBHA Autophagy-related protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG2 PE=3 SV=2 748 846 4.0E-10
sp|Q59X11|ATG2_CANAL Autophagy-related protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG2 PE=3 SV=1 743 846 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5248
MVILFSDARLQTLTAPVKGKTTASMNINKASILLADCVAEANATPTLDSPTTRTASQRNPSVSLSPVVAELCAKG
FVDICYISSASVVATVKSIPGALNGEKQVEVLIRDDLLVLETCPDSTQTLIAMINALKPPTPPSKEDRYRTSIMP
MQDLLASISAEAFGKPEGDYDFDQDFAGAQEMMARSVSDAGYDDKLDPSLRSRSSLDAGDESVAEELFDATRVFP
VCSREDTLMQDTAEGVLLTGPKQAEDIIEQDSSQELVIHEDYYARDEAESVHSAKMWNSSKNTYDQAPDSLVNFS
PLKLSIRDVHIIWNLFDGYDWARTREVITKAVEDIESKAIERQQRLGSASQVYEEELEEEEAIGDFLFNSIYIGV
DMNRDPRDLTRVINEGLNDDVTETETVTTATTSRTVRQTHRHSRPKSKRLRLGRSKRHKITFELRGVDADMVMFP
APESASGQETLSSIDLRISNLEIFDHVPTSTWKKFATYDQDRGEREMGTGMVHLELLTVRPIPQLAASEIVMRVK
VLPLRLHVDQDALDFVTRFFEFKDDNSGSTCDSSVSDIPFIQRAEILDIPVKLDFKPKRVDYAGLRSGHTTEFMN
FIVLEEARMVMRHAIVYGVSGFDRLGKTLNDIWMPDVRRNQLPGVVAGLAPVRSLVNIGSGFKDLVEIPLREYRK
DGRVVRSISKGAFAFARTTGTELVKLGAKIAVGTQYALAGAEEMLSDKSSREAAESNWEDFDDGAEGESEEKKQI
SLYADQPTGVMQGIRGGYRSLTRDVNLARDAIIAVPGEAMESGTASGAARAVLKRAPTIIFRPAMGVTKAIGQTL
LGATNSIDPENKRRISEKYKH*
Coding >OphauB2|5248
ATGGTTATTCTCTTCAGCGACGCCCGTCTGCAGACACTTACAGCACCTGTCAAAGGTAAAACGACGGCAAGCATG
AATATCAACAAAGCCTCCATCTTGTTGGCCGATTGTGTTGCTGAAGCCAATGCCACACCGACATTGGACAGTCCT
ACCACGCGTACAGCTTCTCAGCGGAATCCATCCGTCTCCCTCTCACCCGTCGTGGCAGAACTTTGCGCAAAGGGA
TTTGTGGACATCTGCTACATCTCATCGGCTAGTGTGGTGGCTACGGTGAAGTCGATACCGGGAGCCTTGAATGGG
GAAAAACAAGTCGAGGTGTTGATTCGCGATGATTTGCTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACGCTC
ATTGCCATGATTAATGCTCTCAAACCTCCGACGCCACCGAGCAAAGAGGACAGATACCGGACAAGTATTATGCCC
ATGCAAGATTTGCTGGCATCTATATCTGCCGAGGCTTTTGGTAAGCCCGAGGGCGATTATGATTTTGACCAAGAT
TTTGCCGGGGCACAGGAAATGATGGCAAGAAGCGTCTCAGACGCTGGCTATGATGACAAGCTGGATCCCTCATTA
CGCTCTCGTTCCTCGCTGGATGCTGGAGATGAGTCTGTTGCTGAAGAGCTCTTTGACGCCACCAGAGTATTTCCT
GTGTGCTCACGCGAGGACACTCTAATGCAGGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAGCAAGCCGAA
GATATCATTGAACAGGATAGCAGCCAGGAACTAGTCATTCACGAAGATTACTATGCGCGCGACGAGGCCGAGAGT
GTCCATTCAGCCAAGATGTGGAATTCAAGCAAGAACACCTACGACCAGGCTCCCGATTCTCTGGTTAATTTCAGT
CCGCTCAAATTGTCCATACGGGATGTGCACATCATTTGGAACCTGTTTGATGGTTATGACTGGGCGCGCACGCGT
GAAGTGATTACAAAGGCTGTCGAAGACATTGAGTCCAAGGCCATTGAGCGGCAGCAGCGTTTAGGCAGCGCAAGC
CAGGTGTACGAAGAGGAACTGGAAGAAGAGGAGGCTATTGGCGACTTCTTGTTCAACTCGATATACATTGGAGTT
GACATGAATCGCGATCCGCGAGACCTTACCAGAGTCATTAATGAAGGGCTCAATGACGATGTCACTGAGACGGAG
ACGGTAACGACGGCAACAACAAGCCGCACTGTACGCCAGACTCATCGGCATTCTCGGCCCAAGTCAAAACGCCTC
AGGCTCGGCCGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTGGACGCTGACATGGTCATGTTTCCC
GCGCCCGAGTCTGCCAGCGGTCAAGAAACATTGAGCAGTATCGATTTGAGAATCTCAAATTTGGAAATCTTTGAC
CACGTGCCCACATCGACCTGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATGGGAACTGGC
ATGGTTCACCTTGAATTATTGACAGTGCGTCCCATTCCTCAGCTTGCAGCGTCGGAAATCGTAATGCGGGTCAAG
GTTTTGCCTCTGCGGTTGCACGTGGACCAGGATGCACTCGACTTTGTGACGCGTTTTTTCGAGTTCAAAGATGAC
AACAGCGGAAGCACATGTGACTCGTCAGTCAGTGATATCCCTTTTATACAACGGGCTGAAATCCTCGATATACCC
GTAAAACTAGACTTCAAGCCAAAGCGTGTCGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAATTCATGAAC
TTTATCGTGCTGGAGGAGGCGCGCATGGTGATGCGGCATGCCATTGTATATGGTGTGTCGGGGTTTGACCGCCTA
GGGAAAACGCTCAATGACATTTGGATGCCAGATGTCCGCAGGAATCAGCTTCCTGGGGTGGTGGCTGGTCTAGCA
CCGGTTCGGTCGCTTGTCAACATTGGAAGCGGCTTCAAAGACTTGGTTGAGATTCCGCTGCGCGAGTACCGCAAG
GACGGGCGCGTCGTTCGCAGCATTTCCAAGGGAGCGTTTGCCTTTGCGAGAACTACGGGAACAGAACTCGTCAAG
CTGGGTGCCAAGATTGCTGTGGGCACTCAATACGCTCTTGCCGGTGCCGAGGAGATGTTGTCGGACAAGTCGAGT
CGAGAAGCGGCCGAATCAAACTGGGAAGATTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAAGAAGCAAATT
TCGCTCTACGCTGACCAGCCGACGGGCGTGATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACGCGAGACGTC
AACTTGGCCAGAGATGCCATTATCGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACGGCCAGCGGCGCAGCACGT
GCTGTTCTTAAAAGGGCTCCAACCATTATTTTCCGACCTGCCATGGGAGTCACCAAGGCTATTGGGCAGACTCTG
TTGGGTGCGACAAATAGCATTGATCCGGAGAATAAGCGAAGGATCAGCGAGAAATATAAGCATTAA
Transcript >OphauB2|5248
ATGGTTATTCTCTTCAGCGACGCCCGTCTGCAGACACTTACAGCACCTGTCAAAGGTAAAACGACGGCAAGCATG
AATATCAACAAAGCCTCCATCTTGTTGGCCGATTGTGTTGCTGAAGCCAATGCCACACCGACATTGGACAGTCCT
ACCACGCGTACAGCTTCTCAGCGGAATCCATCCGTCTCCCTCTCACCCGTCGTGGCAGAACTTTGCGCAAAGGGA
TTTGTGGACATCTGCTACATCTCATCGGCTAGTGTGGTGGCTACGGTGAAGTCGATACCGGGAGCCTTGAATGGG
GAAAAACAAGTCGAGGTGTTGATTCGCGATGATTTGCTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACGCTC
ATTGCCATGATTAATGCTCTCAAACCTCCGACGCCACCGAGCAAAGAGGACAGATACCGGACAAGTATTATGCCC
ATGCAAGATTTGCTGGCATCTATATCTGCCGAGGCTTTTGGTAAGCCCGAGGGCGATTATGATTTTGACCAAGAT
TTTGCCGGGGCACAGGAAATGATGGCAAGAAGCGTCTCAGACGCTGGCTATGATGACAAGCTGGATCCCTCATTA
CGCTCTCGTTCCTCGCTGGATGCTGGAGATGAGTCTGTTGCTGAAGAGCTCTTTGACGCCACCAGAGTATTTCCT
GTGTGCTCACGCGAGGACACTCTAATGCAGGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAGCAAGCCGAA
GATATCATTGAACAGGATAGCAGCCAGGAACTAGTCATTCACGAAGATTACTATGCGCGCGACGAGGCCGAGAGT
GTCCATTCAGCCAAGATGTGGAATTCAAGCAAGAACACCTACGACCAGGCTCCCGATTCTCTGGTTAATTTCAGT
CCGCTCAAATTGTCCATACGGGATGTGCACATCATTTGGAACCTGTTTGATGGTTATGACTGGGCGCGCACGCGT
GAAGTGATTACAAAGGCTGTCGAAGACATTGAGTCCAAGGCCATTGAGCGGCAGCAGCGTTTAGGCAGCGCAAGC
CAGGTGTACGAAGAGGAACTGGAAGAAGAGGAGGCTATTGGCGACTTCTTGTTCAACTCGATATACATTGGAGTT
GACATGAATCGCGATCCGCGAGACCTTACCAGAGTCATTAATGAAGGGCTCAATGACGATGTCACTGAGACGGAG
ACGGTAACGACGGCAACAACAAGCCGCACTGTACGCCAGACTCATCGGCATTCTCGGCCCAAGTCAAAACGCCTC
AGGCTCGGCCGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTGGACGCTGACATGGTCATGTTTCCC
GCGCCCGAGTCTGCCAGCGGTCAAGAAACATTGAGCAGTATCGATTTGAGAATCTCAAATTTGGAAATCTTTGAC
CACGTGCCCACATCGACCTGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATGGGAACTGGC
ATGGTTCACCTTGAATTATTGACAGTGCGTCCCATTCCTCAGCTTGCAGCGTCGGAAATCGTAATGCGGGTCAAG
GTTTTGCCTCTGCGGTTGCACGTGGACCAGGATGCACTCGACTTTGTGACGCGTTTTTTCGAGTTCAAAGATGAC
AACAGCGGAAGCACATGTGACTCGTCAGTCAGTGATATCCCTTTTATACAACGGGCTGAAATCCTCGATATACCC
GTAAAACTAGACTTCAAGCCAAAGCGTGTCGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAATTCATGAAC
TTTATCGTGCTGGAGGAGGCGCGCATGGTGATGCGGCATGCCATTGTATATGGTGTGTCGGGGTTTGACCGCCTA
GGGAAAACGCTCAATGACATTTGGATGCCAGATGTCCGCAGGAATCAGCTTCCTGGGGTGGTGGCTGGTCTAGCA
CCGGTTCGGTCGCTTGTCAACATTGGAAGCGGCTTCAAAGACTTGGTTGAGATTCCGCTGCGCGAGTACCGCAAG
GACGGGCGCGTCGTTCGCAGCATTTCCAAGGGAGCGTTTGCCTTTGCGAGAACTACGGGAACAGAACTCGTCAAG
CTGGGTGCCAAGATTGCTGTGGGCACTCAATACGCTCTTGCCGGTGCCGAGGAGATGTTGTCGGACAAGTCGAGT
CGAGAAGCGGCCGAATCAAACTGGGAAGATTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAAGAAGCAAATT
TCGCTCTACGCTGACCAGCCGACGGGCGTGATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACGCGAGACGTC
AACTTGGCCAGAGATGCCATTATCGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACGGCCAGCGGCGCAGCACGT
GCTGTTCTTAAAAGGGCTCCAACCATTATTTTCCGACCTGCCATGGGAGTCACCAAGGCTATTGGGCAGACTCTG
TTGGGTGCGACAAATAGCATTGATCCGGAGAATAAGCGAAGGATCAGCGAGAAATATAAGCATTAA
Gene >OphauB2|5248
ATGGTTATTCTCTTCAGCGACGCCCGTCTGCAGACACTTACAGCACCTGTCAAAGGTAAAACGACGGCAAGCATG
AATATCAACAAAGCCTCCATCTTGTTGGCCGATTGTGTTGCTGAAGCCAATGCCACACCGACATTGGACAGTCCT
ACCACGCGTACAGCTTCTCAGCGGAATCCATCCGTCTCCCTCTCACCCGTCGTGGCAGAACTTTGCGCAAAGGGA
TTTGTGGACATCTGCTACATCTCATCGGCTAGTGTGGTGGCTACGGTGAAGTCGATACCGGGAGCCTTGAATGGG
GAAAAACAAGTCGAGGTGTTGATTCGCGATGATTTGCTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACGCTC
ATTGCCATGATTAATGCTCTCAAACCTCCGACGCCACCGAGCAAAGAGGACAGATACCGGACAAGTATTATGCCC
ATGCAAGATTTGCTGGCATCTATATCTGCCGAGGCTTTTGGTAAGCCCGAGGGCGATTATGATTTTGACCAAGAT
TTTGCCGGGGCACAGGAAATGATGGCAAGAAGCGTCTCAGACGCTGGCTATGATGACAAGCTGGATCCCTCATTA
CGCTCTCGTTCCTCGCTGGATGCTGGAGATGAGTCTGTTGCTGAAGAGCTCTTTGACGCCACCAGAGTATTTCCT
GTGTGCTCACGCGAGGACACTCTAATGCAGGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAGCAAGCCGAA
GATATCATTGAACAGGATAGCAGCCAGGAACTAGTCATTCACGAAGATTACTATGCGCGCGACGAGGCCGAGAGT
GTCCATTCAGCCAAGATGTGGAATTCAAGCAAGAACACCTACGACCAGGCTCCCGATTCTCTGGTTAATTTCAGT
CCGCTCAAATTGTCCATACGGGATGTGCACATCATTTGGAACCTGTTTGATGGTTATGACTGGGCGCGCACGCGT
GAAGTGATTACAAAGGCTGTCGAAGACATTGAGTCCAAGGCCATTGAGCGGCAGCAGCGTTTAGGCAGCGCAAGC
CAGGTGTACGAAGAGGAACTGGAAGAAGAGGAGGCTATTGGCGACTTCTTGTTCAACTCGATATACATTGGAGTT
GACATGAATCGCGATCCGCGAGACCTTACCAGAGTCATTAATGAAGGGCTCAATGACGATGTCACTGAGACGGAG
ACGGTAACGACGGCAACAACAAGCCGCACTGTACGCCAGACTCATCGGCATTCTCGGCCCAAGTCAAAACGCCTC
AGGCTCGGCCGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTGGACGCTGACATGGTCATGTTTCCC
GCGCCCGAGTCTGCCAGCGGTCAAGAAACATTGAGCAGTATCGATTTGAGAATCTCAAATTTGGAAATCTTTGAC
CACGTGCCCACATCGACCTGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATGGGAACTGGC
ATGGTTCACCTTGAATTATTGACAGTGCGTCCCATTCCTCAGCTTGCAGCGTCGGAAATCGTAATGCGGGTCAAG
GTTTTGCCTCTGCGGTTGCACGTGGACCAGGATGCACTCGACTTTGTGACGCGTTTTTTCGAGTTCAAAGATGAC
AACAGCGGAAGCACATGTGACTCGTCAGTCAGTGATATCCCTTTTATACAACGGGCTGAAATCCTCGATATACCC
GTAAAACTAGACTTCAAGCCAAAGCGTGTCGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAATTCATGAAC
TTTATCGTGCTGGAGGAGGCGCGCATGGTGATGCGGCATGCCATTGTATATGGTGTGTCGGGGTTTGACCGCCTA
GGGAAAACGCTCAATGACATTTGGATGCCAGATGTCCGCAGGAATCAGCTTCCTGGGGTGGTGGCTGGTCTAGCA
CCGGTTCGGTCGCTTGTCAACATTGGAAGCGGCTTCAAAGACTTGGTTGAGATTCCGCTGCGCGAGTACCGCAAG
GACGGGCGCGTCGTTCGCAGCATTTCCAAGGGAGCGTTTGCCTTTGCGAGAACTACGGGAACAGAACTCGTCAAG
CTGGGTGCCAAGATTGCTGTGGGCACTCAATACGCTCTTGCCGGTGCCGAGGAGATGTTGTCGGACAAGTCGAGT
CGAGAAGCGGCCGAATCAAACTGGGAAGATTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAAGAAGCAAATT
TCGCTCTACGCTGACCAGCCGACGGGCGTGATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACGCGAGACGTC
AACTTGGCCAGAGATGCCATTATCGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACGGCCAGCGGCGCAGCACGT
GCTGTTCTTAAAAGGGCTCCAACCATTATTTTCCGACCTGCCATGGGAGTCACCAAGGCTATTGGGCAGACTCTG
TTGGGTGCGACAAATAGCATTGATCCGGAGAATAAGCGAAGGATCAGCGAGGCGAGTCTAGCTTTTGATATTGTT
TGCTGTGGCTAGAGTCATTCCAGCTAACCATGAAGATAGAAATATAAGCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail