Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5239
Gene name
LocationContig_4:102772..105146
Strand-
Gene length (bp)2374
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 1.7E-20 17 107
PF14604 SH3_9 Variant SH3 domain 1.9E-07 586 633
PF14604 SH3_9 Variant SH3 domain 2.2E-10 679 728
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 9.5E-15 407 457
PF00018 SH3_1 SH3 domain 1.1E-06 586 629

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 10 727 4.0E-118
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 9 397 2.0E-67
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 579 728 2.0E-13
sp|Q6GNV5|FNBP1_XENLA Formin-binding protein 1 homolog OS=Xenopus laevis GN=fnbp1 PE=2 SV=1 9 296 3.0E-13
sp|Q5RCJ1|CIP4_PONAB Cdc42-interacting protein 4 OS=Pongo abelii GN=TRIP10 PE=2 SV=1 10 296 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 10 727 4.0E-118
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 9 397 2.0E-67
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 579 728 2.0E-13
sp|Q6GNV5|FNBP1_XENLA Formin-binding protein 1 homolog OS=Xenopus laevis GN=fnbp1 PE=2 SV=1 9 296 3.0E-13
sp|Q5RCJ1|CIP4_PONAB Cdc42-interacting protein 4 OS=Pongo abelii GN=TRIP10 PE=2 SV=1 10 296 4.0E-13
sp|Q15642|CIP4_HUMAN Cdc42-interacting protein 4 OS=Homo sapiens GN=TRIP10 PE=1 SV=3 10 296 5.0E-13
sp|P97531|CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus GN=Trip10 PE=1 SV=3 10 245 5.0E-12
sp|Q8CJ53|CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus GN=Trip10 PE=1 SV=2 10 296 7.0E-12
sp|Q96RU3|FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens GN=FNBP1 PE=1 SV=2 9 296 9.0E-11
sp|Q8R511|FNBP1_RAT Formin-binding protein 1 OS=Rattus norvegicus GN=Fnbp1 PE=1 SV=2 9 296 2.0E-10
sp|Q80TY0|FNBP1_MOUSE Formin-binding protein 1 OS=Mus musculus GN=Fnbp1 PE=1 SV=2 9 296 3.0E-10
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 364 458 3.0E-10
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 382 456 4.0E-10
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 382 456 5.0E-10
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 405 456 6.0E-10
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 405 456 7.0E-10
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 364 458 7.0E-10
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 405 456 7.0E-10
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 405 456 1.0E-09
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 405 456 2.0E-09
sp|Q55DK5|MGP3_DICDI Mental retardation GTPase activating protein homolog 3 OS=Dictyostelium discoideum GN=mgp3 PE=3 SV=1 8 235 2.0E-09
sp|Q1LZ97|GRP4_BOVIN RAS guanyl-releasing protein 4 OS=Bos taurus GN=RASGRP4 PE=2 SV=1 388 456 7.0E-09
sp|Q5U3Q6|CIP4_DANRE Cdc42-interacting protein 4 homolog OS=Danio rerio GN=trip10 PE=2 SV=1 10 296 7.0E-09
sp|A4IJ06|GRP1_XENTR RAS guanyl-releasing protein 1 OS=Xenopus tropicalis GN=rasgrp1 PE=2 SV=1 381 456 1.0E-08
sp|Q6NTL4|GRP1_XENLA RAS guanyl-releasing protein 1 OS=Xenopus laevis GN=rasgrp1 PE=2 SV=1 381 456 1.0E-08
sp|Q8TDF6|GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens GN=RASGRP4 PE=1 SV=2 388 456 1.0E-08
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 407 462 1.0E-08
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 407 458 1.0E-08
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 407 465 1.0E-08
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens GN=RASGRP1 PE=1 SV=2 391 456 2.0E-08
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 404 458 2.0E-08
sp|Q8BTM9|GRP4_MOUSE RAS guanyl-releasing protein 4 OS=Mus musculus GN=Rasgrp4 PE=1 SV=1 388 456 2.0E-08
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus GN=Rasgrp1 PE=1 SV=1 391 456 2.0E-08
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 404 458 2.0E-08
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 404 458 2.0E-08
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 404 458 2.0E-08
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 404 458 3.0E-08
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus GN=Rasgrp1 PE=1 SV=1 391 456 3.0E-08
sp|Q32N25|GRP2A_XENLA RAS guanyl-releasing protein 2-A OS=Xenopus laevis GN=rasgrp2-a PE=2 SV=1 395 456 3.0E-08
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 405 458 3.0E-08
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 404 458 4.0E-08
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 404 458 5.0E-08
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 382 460 9.0E-08
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 407 523 1.0E-07
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 407 528 1.0E-07
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 407 458 1.0E-07
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 407 458 1.0E-07
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 407 458 1.0E-07
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 404 458 1.0E-07
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 404 458 1.0E-07
sp|Q99MK9|RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus GN=Rassf1 PE=2 SV=1 404 458 1.0E-07
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 404 458 1.0E-07
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 404 458 1.0E-07
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 407 459 2.0E-07
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 407 459 2.0E-07
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 382 460 2.0E-07
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 404 458 2.0E-07
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 404 458 2.0E-07
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 407 459 2.0E-07
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 407 459 2.0E-07
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 407 459 2.0E-07
sp|Q2HWF0|FBP1L_RAT Formin-binding protein 1-like OS=Rattus norvegicus GN=Fnbp1l PE=1 SV=2 9 296 2.0E-07
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 407 457 2.0E-07
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 404 469 2.0E-07
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 404 469 2.0E-07
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 404 469 2.0E-07
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 404 469 2.0E-07
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 407 459 3.0E-07
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 407 459 3.0E-07
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 407 528 3.0E-07
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 407 528 3.0E-07
sp|Q8K012|FBP1L_MOUSE Formin-binding protein 1-like OS=Mus musculus GN=Fnbp1l PE=1 SV=2 9 296 3.0E-07
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 404 458 3.0E-07
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 404 469 3.0E-07
sp|Q5T0N5|FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens GN=FNBP1L PE=1 SV=3 9 296 3.0E-07
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 404 469 3.0E-07
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 407 484 3.0E-07
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 405 458 3.0E-07
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 382 460 3.0E-07
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 405 458 3.0E-07
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 382 456 3.0E-07
sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 407 484 3.0E-07
sp|Q9UPW8|UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens GN=UNC13A PE=2 SV=4 407 484 3.0E-07
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 407 483 4.0E-07
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 407 483 4.0E-07
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 407 483 4.0E-07
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 407 483 4.0E-07
sp|Q8IV61|GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens GN=RASGRP3 PE=1 SV=1 407 499 4.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 557 727 4.0E-07
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 404 458 4.0E-07
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 405 458 5.0E-07
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 407 459 5.0E-07
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 404 458 5.0E-07
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 407 483 6.0E-07
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 405 458 6.0E-07
sp|Q8NB66|UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens GN=UNC13C PE=2 SV=3 407 456 6.0E-07
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 404 458 6.0E-07
sp|Q62770|UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus GN=Unc13c PE=1 SV=3 407 456 6.0E-07
sp|Q8K0T7|UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus GN=Unc13c PE=1 SV=3 407 456 6.0E-07
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 407 458 7.0E-07
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 407 461 8.0E-07
sp|Q8NEN9|PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens GN=PDZD8 PE=1 SV=1 397 516 9.0E-07
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 407 456 1.0E-06
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 407 456 1.0E-06
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 407 456 1.0E-06
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 407 456 1.0E-06
sp|O14795|UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens GN=UNC13B PE=1 SV=2 407 456 1.0E-06
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 405 458 1.0E-06
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 407 497 2.0E-06
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 382 456 2.0E-06
sp|Q9NS23|RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens GN=RASSF1 PE=1 SV=1 404 458 2.0E-06
sp|P27715|UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans GN=unc-13 PE=1 SV=4 407 475 2.0E-06
sp|Q9Z1N9|UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus GN=Unc13b PE=1 SV=2 407 484 2.0E-06
sp|Q62769|UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus GN=Unc13b PE=1 SV=2 407 484 2.0E-06
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 405 468 2.0E-06
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 404 519 2.0E-06
sp|P34125|DGKA_DICDI Diacylglycerol kinase A OS=Dictyostelium discoideum GN=dgkA PE=1 SV=3 407 456 2.0E-06
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 405 458 2.0E-06
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 405 481 3.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 586 730 3.0E-06
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 407 466 3.0E-06
sp|Q99469|STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens GN=STAC PE=1 SV=1 392 635 3.0E-06
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 586 730 3.0E-06
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 537 727 3.0E-06
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 405 462 4.0E-06
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 407 456 5.0E-06
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 407 477 5.0E-06
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 407 477 5.0E-06
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 385 477 5.0E-06
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 407 456 6.0E-06
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 407 462 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3830
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4205
Ophiocordyceps australis map64 (Brazil) OphauB2|5239 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06865
Ophiocordyceps camponoti-rufipedis Ophun1|4739
Ophiocordyceps kimflemingae Ophio5|925
Ophiocordyceps subramaniannii Hirsu2|7536

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5239
MAEVEAVPTFGSELKDGFKPACAWVGHGIAWLDDMQQYYRDRSAIEKEYSGRLSALAKKYFDKKNKRSAQLSVGD
SPAMTPGSLESASLNTWAAQLTTLESRAAEHDRFATSLVSDVAEPLKQIAVRFDELRKRHADHADRLAADRDASY
ADLRKVKAKYDATCQEVETRRKKTESHSDKAKAQSAYQQQIFDMNNAKNTYLIAINVTNRLKAAYYHQHLPELMD
SLQDLAEFRVMRLNGLWSTATALESDMLRQSLALTDKLGSDIKRNEPQLDSAMYMHHNMAVFNEPADKTFEPSPV
WHDDDVMVVDETAKVYLRNVLSKSKAQLGELRREVDKKRREAQGVTRTKQRVRHGAEKDKDEVEVMRTLFTMQEE
LHAADRRRLTAEVETSTITSAVGDVTLGAKNHNFKGQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHNKCEM
KVPADCPGEQSKEERKKLKAQRQETANRLLVVADPGAPPAHVAELPDLTRSNTMTSLSSHSARRSASGSLSMTPA
TTDEGPTEVPPRTSMSSATGTAPRRRVMAPPPAAYVGEMPGSGINGSKAGADEDRKRGKMLYPFESSNTGELSLP
EGRDVVILEPDDGGWTKVRAGSREGLVPTAYVQVLSAPRPSSTYSNSTASSTTTAPAARRKGPAVAPKRGARKLR
YVEALYAYEARGAAEHSMAEGERFVLVRDDPGDGWVEVEKAGVTANVPAAYVQTL*
Coding >OphauB2|5239
ATGGCAGAGGTGGAAGCCGTGCCCACCTTTGGCAGCGAGCTCAAGGATGGCTTCAAGCCCGCATGCGCCTGGGTC
GGCCATGGAATCGCCTGGCTCGACGACATGCAGCAATACTACCGCGACCGCTCGGCCATTGAGAAGGAATACAGC
GGCCGGCTCAGCGCCCTGGCAAAGAAGTATTTCGACAAGAAGAATAAGCGATCTGCCCAGCTGAGCGTGGGCGAC
TCGCCTGCCATGACGCCCGGCTCGCTCGAGAGCGCCTCGCTCAACACGTGGGCCGCCCAACTCACAACACTTGAG
TCGCGTGCCGCAGAACACGACCGCTTTGCCACGAGCCTTGTTTCCGACGTTGCCGAGCCTCTCAAGCAAATCGCG
GTGCGCTTCGACGAGCTGCGCAAACGCCATGCCGACCATGCCGACCGCCTTGCCGCCGACCGCGACGCCTCGTAT
GCCGACTTGCGCAAGGTCAAGGCCAAGTACGACGCCACGTGCCAGGAGGTCGAGACGCGCCGCAAGAAGACGGAA
TCCCACTCGGACAAGGCCAAGGCCCAGAGCGCCTACCAGCAGCAAATCTTTGACATGAACAATGCCAAAAACACA
TACCTCATTGCCATCAACGTGACGAACCGCCTCAAAGCCGCCTACTACCACCAACACCTTCCCGAGCTCATGGAC
AGCCTTCAGGACCTGGCCGAATTTCGCGTCATGCGCCTCAATGGACTGTGGAGCACCGCCACGGCCCTCGAGTCT
GACATGTTGCGTCAGAGCCTCGCCCTGACGGACAAGCTCGGCTCCGACATTAAGCGCAACGAACCACAACTCGAC
TCCGCCATGTACATGCACCACAACATGGCAGTCTTTAACGAGCCTGCCGACAAGACTTTTGAGCCTAGCCCGGTA
TGGCATGATGACGACGTCATGGTTGTCGATGAAACAGCAAAGGTCTATCTGCGCAACGTGCTAAGCAAGAGCAAG
GCTCAGCTCGGCGAGCTCCGTCGCGAGGTGGACAAGAAGCGCCGCGAAGCCCAAGGCGTCACACGAACCAAGCAA
CGCGTACGCCATGGCGCGGAAAAGGACAAGGATGAGGTTGAAGTCATGCGCACCCTCTTTACCATGCAGGAGGAG
CTTCATGCCGCTGACCGCCGTCGCCTGACTGCCGAGGTGGAAACGTCGACGATTACCTCAGCCGTGGGCGACGTG
ACGCTCGGGGCCAAGAACCACAACTTCAAGGGACAGACTTTTAAAATCCCCACGAATTGCGATCTCTGCGGCGAG
CGCATCTGGGGCCTGAGCGCCAAGGGCTTTGACTGCCGCGACTGCGGCTACACATGCCACAACAAGTGCGAGATG
AAGGTGCCGGCCGACTGCCCCGGCGAGCAGAGCAAGGAGGAGCGCAAGAAGCTCAAGGCCCAGCGCCAAGAGACG
GCCAACCGGCTGCTCGTTGTTGCCGACCCCGGGGCGCCGCCGGCACACGTGGCTGAGCTGCCCGATCTCACCCGG
TCCAACACGATGACGTCGCTGAGCTCGCACTCGGCGCGCCGCTCGGCATCGGGGTCGCTGAGCATGACGCCCGCC
ACGACGGATGAAGGGCCGACAGAGGTGCCGCCGCGAACGAGCATGTCGTCTGCGACGGGGACGGCGCCTCGTAGA
AGAGTCATGGCGCCTCCGCCGGCGGCATATGTTGGCGAGATGCCGGGCAGTGGCATTAACGGCAGCAAGGCTGGC
GCAGACGAGGATCGCAAGCGGGGAAAAATGCTGTATCCCTTTGAGTCGAGCAACACGGGCGAATTGTCCCTCCCC
GAAGGCCGCGACGTAGTCATTCTCGAACCCGATGACGGCGGCTGGACCAAAGTCCGCGCCGGCTCGCGCGAAGGC
CTCGTGCCAACCGCCTACGTGCAAGTCTTGAGCGCGCCCCGCCCCTCGTCCACATACTCCAACTCGACCGCCTCG
TCAACAACAACTGCACCCGCTGCGCGCCGCAAGGGTCCCGCCGTGGCGCCCAAGCGCGGGGCACGCAAGCTGCGC
TACGTCGAGGCGCTGTACGCGTACGAGGCGCGCGGCGCGGCAGAGCATAGCATGGCCGAGGGCGAGCGCTTCGTC
TTGGTGCGCGATGATCCGGGCGATGGATGGGTCGAGGTGGAAAAGGCGGGTGTGACGGCTAATGTGCCGGCTGCC
TATGTCCAGACGCTCTAA
Transcript >OphauB2|5239
ATGGCAGAGGTGGAAGCCGTGCCCACCTTTGGCAGCGAGCTCAAGGATGGCTTCAAGCCCGCATGCGCCTGGGTC
GGCCATGGAATCGCCTGGCTCGACGACATGCAGCAATACTACCGCGACCGCTCGGCCATTGAGAAGGAATACAGC
GGCCGGCTCAGCGCCCTGGCAAAGAAGTATTTCGACAAGAAGAATAAGCGATCTGCCCAGCTGAGCGTGGGCGAC
TCGCCTGCCATGACGCCCGGCTCGCTCGAGAGCGCCTCGCTCAACACGTGGGCCGCCCAACTCACAACACTTGAG
TCGCGTGCCGCAGAACACGACCGCTTTGCCACGAGCCTTGTTTCCGACGTTGCCGAGCCTCTCAAGCAAATCGCG
GTGCGCTTCGACGAGCTGCGCAAACGCCATGCCGACCATGCCGACCGCCTTGCCGCCGACCGCGACGCCTCGTAT
GCCGACTTGCGCAAGGTCAAGGCCAAGTACGACGCCACGTGCCAGGAGGTCGAGACGCGCCGCAAGAAGACGGAA
TCCCACTCGGACAAGGCCAAGGCCCAGAGCGCCTACCAGCAGCAAATCTTTGACATGAACAATGCCAAAAACACA
TACCTCATTGCCATCAACGTGACGAACCGCCTCAAAGCCGCCTACTACCACCAACACCTTCCCGAGCTCATGGAC
AGCCTTCAGGACCTGGCCGAATTTCGCGTCATGCGCCTCAATGGACTGTGGAGCACCGCCACGGCCCTCGAGTCT
GACATGTTGCGTCAGAGCCTCGCCCTGACGGACAAGCTCGGCTCCGACATTAAGCGCAACGAACCACAACTCGAC
TCCGCCATGTACATGCACCACAACATGGCAGTCTTTAACGAGCCTGCCGACAAGACTTTTGAGCCTAGCCCGGTA
TGGCATGATGACGACGTCATGGTTGTCGATGAAACAGCAAAGGTCTATCTGCGCAACGTGCTAAGCAAGAGCAAG
GCTCAGCTCGGCGAGCTCCGTCGCGAGGTGGACAAGAAGCGCCGCGAAGCCCAAGGCGTCACACGAACCAAGCAA
CGCGTACGCCATGGCGCGGAAAAGGACAAGGATGAGGTTGAAGTCATGCGCACCCTCTTTACCATGCAGGAGGAG
CTTCATGCCGCTGACCGCCGTCGCCTGACTGCCGAGGTGGAAACGTCGACGATTACCTCAGCCGTGGGCGACGTG
ACGCTCGGGGCCAAGAACCACAACTTCAAGGGACAGACTTTTAAAATCCCCACGAATTGCGATCTCTGCGGCGAG
CGCATCTGGGGCCTGAGCGCCAAGGGCTTTGACTGCCGCGACTGCGGCTACACATGCCACAACAAGTGCGAGATG
AAGGTGCCGGCCGACTGCCCCGGCGAGCAGAGCAAGGAGGAGCGCAAGAAGCTCAAGGCCCAGCGCCAAGAGACG
GCCAACCGGCTGCTCGTTGTTGCCGACCCCGGGGCGCCGCCGGCACACGTGGCTGAGCTGCCCGATCTCACCCGG
TCCAACACGATGACGTCGCTGAGCTCGCACTCGGCGCGCCGCTCGGCATCGGGGTCGCTGAGCATGACGCCCGCC
ACGACGGATGAAGGGCCGACAGAGGTGCCGCCGCGAACGAGCATGTCGTCTGCGACGGGGACGGCGCCTCGTAGA
AGAGTCATGGCGCCTCCGCCGGCGGCATATGTTGGCGAGATGCCGGGCAGTGGCATTAACGGCAGCAAGGCTGGC
GCAGACGAGGATCGCAAGCGGGGAAAAATGCTGTATCCCTTTGAGTCGAGCAACACGGGCGAATTGTCCCTCCCC
GAAGGCCGCGACGTAGTCATTCTCGAACCCGATGACGGCGGCTGGACCAAAGTCCGCGCCGGCTCGCGCGAAGGC
CTCGTGCCAACCGCCTACGTGCAAGTCTTGAGCGCGCCCCGCCCCTCGTCCACATACTCCAACTCGACCGCCTCG
TCAACAACAACTGCACCCGCTGCGCGCCGCAAGGGTCCCGCCGTGGCGCCCAAGCGCGGGGCACGCAAGCTGCGC
TACGTCGAGGCGCTGTACGCGTACGAGGCGCGCGGCGCGGCAGAGCATAGCATGGCCGAGGGCGAGCGCTTCGTC
TTGGTGCGCGATGATCCGGGCGATGGATGGGTCGAGGTGGAAAAGGCGGGTGTGACGGCTAATGTGCCGGCTGCC
TATGTCCAGACGCTCTAA
Gene >OphauB2|5239
ATGGCAGAGGTGGAAGCCGTGCCCACCTTTGGCAGCGAGCTCAAGGTGCCTTGGCCTCCTTGTTGATGCAGGGCA
TCGCTGACTGTCTACAGGATGGCTTCAAGCCCGCATGCGCCTGGGTCGGCCATGGAATCGCCTGGCTCGACGACA
TGCAGCAATACTACCGCGACCGCTCGGCCATTGAGAAGGAATACAGCGGCCGGCTCAGCGCCCTGGCAAAGAAGT
ATTTCGACAAGAAGAATAAGCGATCTGCCCAGCTGAGCGTGGGCGACTCGCCTGCCATGACGCCCGGCTCGCTCG
AGAGGTATTGTGGCTGTCCTTGAAGTCCCCCCTTGTTGGTTCCTGACAGCCACGCACAGCGCCTCGCTCAACACG
TGGGCCGCCCAACTCACAACACTTGAGTCGCGTGCCGCAGAACACGACCGCTTTGCCACGAGCCTTGTTTCCGAC
GTTGCCGAGCCTCTCAAGCAAATCGCGGTGCGCTTCGACGAGCTGCGCAAACGCCATGCCGACCATGCCGACCGC
CTTGCCGCCGACCGCGACGCCTCGTATGCCGACTTGCGCAAGGTCAAGGCCAAGTACGACGCCACGTGCCAGGAG
GTCGAGACGCGCCGCAAGAAGACGGAATCCCACTCGGACAAGGCCAAGGCCCAGAGCGCCTACCAGCAGCAAATC
TTTGACATGAACAATGCCAAAAACACATACCTCATTGCCATCAACGTGACGAACCGCCTCAAAGCCGCCTACTAC
CACCAACACCTTCCCGAGCTCATGGACAGCCTTCAGGACCTGGCCGAATTTCGCGTCATGCGCCTCAATGGACTG
TGGAGCACCGCCACGGCCCTCGAGTCTGACATGTTGCGTCAGAGCCTCGCCCTGACGGACAAGCTCGGCTCCGAC
ATTAAGCGCAACGAACCACAACTCGACTCCGCCATGTACATGCACCACAACATGGCAGTCTTTAACGAGCCTGCC
GACAAGACTTTTGAGCCTAGCCCGGTATGGCATGATGACGACGTCATGGTTGTCGATGAAACAGCAAAGGTCTAT
CTGCGCAACGTGCTAAGCAAGAGCAAGGCTCAGCTCGGCGAGCTCCGTCGCGAGGTGGACAAGAAGCGCCGCGAA
GCCCAAGGCGTCACACGAACCAAGCAACGCGTACGCCATGGCGCGGAAAAGGACAAGGATGAGGTTGAAGTCATG
CGCACCCTCTTTACCATGCAGGAGGAGCTTCATGCCGCTGACCGCCGTCGCCTGACTGCCGAGGTGGAAACGTCG
ACGATTACCTCAGCCGTGGGCGACGTGACGCTCGGGGCCAAGAACCACAACTTCAAGGGACAGACTTTTAAAATC
CCCACGAATTGCGATCTCTGCGGCGAGCGCATCTGGGGCCTGAGCGCCAAGGGCTTTGACTGCCGCGACTGCGGC
TACACATGCCACAACAAGTGCGAGATGAAGGTGCCGGCCGACTGCCCCGGCGAGCAGAGCAAGGAGGAGCGCAAG
AAGCTCAAGGCCCAGCGCCAAGAGACGGCCAACCGGCTGCTCGTTGTTGCCGACCCCGGGGCGCCGCCGGCACAC
GTGGCTGAGCTGCCCGATCTCACCCGGTCCAACACGATGACGTCGCTGAGCTCGCACTCGGCGCGCCGCTCGGCA
TCGGGGTCGCTGAGCATGACGCCCGCCACGACGGATGAAGGGCCGACAGAGGTGCCGCCGCGAACGAGCATGTCG
TCTGCGACGGGGACGGCGCCTCGTAGAAGAGTCATGGCGCCTCCGCCGGCGGCATATGTTGGCGAGATGCCGGGC
AGTGGCATTAACGGCAGCAAGGCTGGCGCAGACGAGGATCGCAAGCGGGGAAAAATGCTGTATCCCTTTGAGTCG
AGCAACACGGGCGAATTGTCCCTCCCCGAAGGCCGCGACGTAGTCATTCTCGAACCCGATGGTATGCTCTCTCAT
TTCTTTGTCTTGTTCCTTTTCAATATTACTATACAAGTTAAAGGTAAACAACTAACACGCCACAGACGGCGGCTG
GACCAAAGTCCGCGCCGGCTCGCGCGAAGGCCTCGTGCCAACCGCCTACGTGCAAGTCTTGAGCGCGCCCCGCCC
CTCGTCCACATACTCCAACTCGACCGCCTCGTCAACAACAACTGCACCCGCTGCGCGCCGCAAGGGTCCCGCCGT
GGCGCCCAAGCGCGGGGCACGCAAGCTGCGCTACGTCGAGGCGCTGTACGCGTACGAGGCGCGCGGCGCGGCAGA
GCATAGCATGGCCGAGGGCGAGCGCTTCGTCTTGGTGCGCGATGATCCGGGCGATGGATGGGTCGAGGTGGAAAA
GGCGGGTGTGACGGCTAATGTGCCGGCTGCCTATGTCCAGACGCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail